KEGG   Xenopus laevis (African clawed frog): 100037174Help
Entry
100037174         CDS       T01010                                 

Gene name
suv39h2.L, kmt1b, suv39h2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2 L homeolog
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100037174 (suv39h2.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100037174 (suv39h2.L)
Chromosome [BR:xla03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100037174 (suv39h2.L)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100037174 (suv39h2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 100037174
NCBI-ProteinID: NP_001091337
Xenbase: XB-GENE-866435
UniProt: A2VD66
Position
3L
AA seq 406 aa AA seqDB search
MAAARGAWCVPCLASIETLQELCRKEMLTCTNIGITRKNLNNYEVEYLCDYRIEKGVEKF
LVKWKGWPESCNSWEPTKNLKCPTLLKQFYSDLYKYLYALKPNKKGVIKNNIKSLDPSLS
DYIVKKAKQRIALRRWEEELNRKKSHSGTLFVENAVDLEGPPIDFYYINDYKASPGVNTL
GEAIVGCDCSDCFNGKCCPTEAGVLFAYNEHKQLKIPPGRPIFECNSRCKCGPDCPNRVV
QKGPPYSLCIFRTDNGRGWGVKTLQKIKKNSFVMEYVGEVITSEEAERRGQQYDSKGITY
LFDLDYEADEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDVRLPRIALFSTRNIKA
GEELTFDYQMKGYGDLSTDSIDMSPAKKRGRIACKCGAATCRGYLN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagcgcgtggagcttggtgtgtaccatgccttgcttccattgaaacgttgcag
gagttatgcagaaaagaaatgctcacttgtacaaacattggaattaccaggaaaaatcta
aataattatgaagtcgaatatctatgtgactacaggattgaaaagggtgtggaaaaattc
cttgtgaagtggaagggatggccagagtcttgtaattcatgggagcctacaaaaaacttg
aaatgtccaacacttctaaaacagttttacagcgacctttataagtatttatatgcactt
aaaccaaataaaaaaggggtcataaaaaataatattaagtctttggacccttctctttct
gactatatagtcaaaaaggctaaacaaaggattgctctacggcgctgggaagaagagctg
aacaggaaaaaatcccatagtggtacactttttgttgaaaatgctgttgatttagagggt
cctcctatagacttttactatatcaatgattataaggcctctcctggagttaacacattg
ggtgaagccattgttggctgtgactgctcggactgctttaacggcaaatgttgtcccaca
gaagcaggagtcctttttgcatataatgaacacaaacagttaaaaatcccaccaggaaga
ccaatttttgaatgcaattcaagatgcaaatgtggtccggattgtcctaacagggtggtg
caaaaggggccaccctattctttatgcatctttaggacagacaatggccgaggttggggt
gtgaagacactccaaaaaataaagaaaaatagttttgtgatggaatatgttggtgaggta
ataacaagtgaggaggcagagagacggggccaacagtatgacagcaaaggaatcacatat
ctatttgatttagactatgaagcagatgagtttacagtggatgcagctcgatatgggaac
gtctcacattttgtgaatcacagttgtgatccaaatcttcaggtttttaatgtcttcatt
gataaccttgatgtacgtcttccgcgtatagcgttattttcaacaaggaatatcaaggcc
ggagaagaacttacatttgattaccaaatgaaaggttatggtgacctcagtacagattct
attgatatgagccctgccaagaaaagagggaggatagcctgcaaatgtggagctgccacc
tgtcgtggataccttaactaa

DBGET integrated database retrieval system