KEGG   Xenopus laevis (African clawed frog): 100037174Help
Entry
100037174         CDS       T01010                                 

Gene name
suv39h2, kmt1b
Definition
suppressor of variegation 3-9 homolog 2 (EC:2.1.1.43)
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:xla00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 406 aa AA seqDB search
MAAARGAWCVPCLASIETLQELCRKEMLTCTNIGITRKNLNNYEVEYLCDYRIEKGVEKF
LVKWKGWPESCNSWEPTKNLKCPTLLKQFYSDLYKYLYALKPNKKGVIKNNIKSLDPSLS
DYIVKKAKQRIALRRWEEELNRKKSHSGTLFVENAVDLEGPPIDFYYINDYKASPGVNTL
GEAIVGCDCSDCFNGKCCPTEAGVLFAYNEHKQLKIPPGRPIFECNSRCKCGPDCPNRVV
QKGPPYSLCIFRTDNGRGWGVKTLQKIKKNSFVMEYVGEVITSEEAERRGQQYDSKGITY
LFDLDYEADEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDVRLPRIALFSTRNIKA
GEELTFDYQMKGYGDLSTDSIDMSPAKKRGRIACKCGAATCRGYLN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagcgcgtggagcttggtgtgtaccatgccttgcttccattgaaacgttgcag
gagttatgcagaaaagaaatgctcacttgtacaaacattggaattaccaggaaaaatcta
aataattatgaagtcgaatatctatgtgactacaggattgaaaagggtgtggaaaaattc
cttgtgaagtggaagggatggccagagtcttgtaattcatgggagcctacaaaaaacttg
aaatgtccaacacttctaaaacagttttacagcgacctttataagtatttatatgcactt
aaaccaaataaaaaaggggtcataaaaaataatattaagtctttggacccttctctttct
gactatatagtcaaaaaggctaaacaaaggattgctctacggcgctgggaagaagagctg
aacaggaaaaaatcccatagtggtacactttttgttgaaaatgctgttgatttagagggt
cctcctatagacttttactatatcaatgattataaggcctctcctggagttaacacattg
ggtgaagccattgttggctgtgactgctcggactgctttaacggcaaatgttgtcccaca
gaagcaggagtcctttttgcatataatgaacacaaacagttaaaaatcccaccaggaaga
ccaatttttgaatgcaattcaagatgcaaatgtggtccggattgtcctaacagggtggtg
caaaaggggccaccctattctttatgcatctttaggacagacaatggccgaggttggggt
gtgaagacactccaaaaaataaagaaaaatagttttgtgatggaatatgttggtgaggta
ataacaagtgaggaggcagagagacggggccaacagtatgacagcaaaggaatcacatat
ctatttgatttagactatgaagcagatgagtttacagtggatgcagctcgatatgggaac
gtctcacattttgtgaatcacagttgtgatccaaatcttcaggtttttaatgtcttcatt
gataaccttgatgtacgtcttccgcgtatagcgttattttcaacaaggaatatcaaggcc
ggagaagaacttacatttgattaccaaatgaaaggttatggtgacctcagtacagattct
attgatatgagccctgccaagaaaagagggaggatagcctgcaaatgtggagctgccacc
tgtcgtggataccttaactaa

DBGET integrated database retrieval system