KEGG   Xenopus laevis (African clawed frog): 100037174Help
Entry
100037174         CDS       T01010                                 

Gene name
suv39h2, kmt1b
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2 (EC:2.1.1.43)
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100037174 (suv39h2)
Enzymes [BR:xla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100037174 (suv39h2)
Chromosome [BR:xla03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100037174 (suv39h2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100037174 (suv39h2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 406 aa AA seqDB search
MAAARGAWCVPCLASIETLQELCRKEMLTCTNIGITRKNLNNYEVEYLCDYRIEKGVEKF
LVKWKGWPESCNSWEPTKNLKCPTLLKQFYSDLYKYLYALKPNKKGVIKNNIKSLDPSLS
DYIVKKAKQRIALRRWEEELNRKKSHSGTLFVENAVDLEGPPIDFYYINDYKASPGVNTL
GEAIVGCDCSDCFNGKCCPTEAGVLFAYNEHKQLKIPPGRPIFECNSRCKCGPDCPNRVV
QKGPPYSLCIFRTDNGRGWGVKTLQKIKKNSFVMEYVGEVITSEEAERRGQQYDSKGITY
LFDLDYEADEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDVRLPRIALFSTRNIKA
GEELTFDYQMKGYGDLSTDSIDMSPAKKRGRIACKCGAATCRGYLN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagcgcgtggagcttggtgtgtaccatgccttgcttccattgaaacgttgcag
gagttatgcagaaaagaaatgctcacttgtacaaacattggaattaccaggaaaaatcta
aataattatgaagtcgaatatctatgtgactacaggattgaaaagggtgtggaaaaattc
cttgtgaagtggaagggatggccagagtcttgtaattcatgggagcctacaaaaaacttg
aaatgtccaacacttctaaaacagttttacagcgacctttataagtatttatatgcactt
aaaccaaataaaaaaggggtcataaaaaataatattaagtctttggacccttctctttct
gactatatagtcaaaaaggctaaacaaaggattgctctacggcgctgggaagaagagctg
aacaggaaaaaatcccatagtggtacactttttgttgaaaatgctgttgatttagagggt
cctcctatagacttttactatatcaatgattataaggcctctcctggagttaacacattg
ggtgaagccattgttggctgtgactgctcggactgctttaacggcaaatgttgtcccaca
gaagcaggagtcctttttgcatataatgaacacaaacagttaaaaatcccaccaggaaga
ccaatttttgaatgcaattcaagatgcaaatgtggtccggattgtcctaacagggtggtg
caaaaggggccaccctattctttatgcatctttaggacagacaatggccgaggttggggt
gtgaagacactccaaaaaataaagaaaaatagttttgtgatggaatatgttggtgaggta
ataacaagtgaggaggcagagagacggggccaacagtatgacagcaaaggaatcacatat
ctatttgatttagactatgaagcagatgagtttacagtggatgcagctcgatatgggaac
gtctcacattttgtgaatcacagttgtgatccaaatcttcaggtttttaatgtcttcatt
gataaccttgatgtacgtcttccgcgtatagcgttattttcaacaaggaatatcaaggcc
ggagaagaacttacatttgattaccaaatgaaaggttatggtgacctcagtacagattct
attgatatgagccctgccaagaaaagagggaggatagcctgcaaatgtggagctgccacc
tgtcgtggataccttaactaa

DBGET integrated database retrieval system