KEGG   Xenopus laevis (African clawed frog): 100037189Help
Entry
100037189         CDS       T01010                                 

Gene name
cyp3a4
Definition
cytochrome P450, family 3, subfamily A, polypeptide 4
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100037189 (cyp3a4)
   00591 Linoleic acid metabolism
    100037189 (cyp3a4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100037189 (cyp3a4)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100037189 (cyp3a4)
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP3 family
   100037189 (cyp3a4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 504 aa AA seqDB search
MNLIPHLSTGTWILLAALFLLILLYGIWPYGFFKKMGIPGPTPLPFIGTFLEFRKGMVQF
DTECFKKYGKMWGTYDGRQPVLAVMDPAIIKTILVKEFYTNFTNRRNFGLNGPFEFAITI
AEDEQWKRIRSVLSPTFTSGKLKEMFQIMKDYSDILVKNIQGYVDKDEPCATKDVIGAYS
MDVITSTSFSVNIDSLNKPSDPFVIHMKKLLTTGLMSPVLILVVIFPFLRPILEGLNLNF
VPNDFTQFFMNAVTSFREKRKKGDHSGRVDLLQLMVDSRTTEGNDLSNQHKALTDAEIMA
QAVIFIVAGYETTSTALSYLFYCLATHPDVQQRLHEEIDSFLPNKASPTYDILMQMEYLD
MVIQETLRLYPPAGRLERVSKQNVEINGVSIPKGTVTMIPAYVLQRDPEYWPEPEEFRPE
RFSKENRETHTPFTFLPFGDGPRNCIGMRFALLSMKVAIVTMLQNFSVRPCAETLIPMEF
STIGFLQPKKPIVLKFLSRTSAQE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcattcctcacctgtcaacagggacatggattctcctggctgctctttttttg
cttatattactctatggcatttggccatatggattctttaagaaaatgggaattcctgga
cctactccattgccgttcataggaacatttctggaatttaggaaagggatggtacagttt
gatacagaatgcttcaaaaaatatgggaagatgtggggaacttatgatgggagacaaccc
gtgcttgcagtcatggaccctgctataattaaaactattcttgtgaaagagttttacaca
aatttcacaaacagacggaattttggtttgaatggcccctttgagtttgccatcactatt
gcagaggatgaacagtggaaaaggattcggagtgtgctctcacctacattcaccagtggg
aaactaaaagagatgttccagataatgaaagattactcagatatccttgtgaaaaacatc
cagggttatgtggacaaagatgagccatgtgcaacaaaggatgtgattggagcatacagc
atggatgtcatcaccagcacctcattcagtgtgaatattgactcccttaacaaaccatca
gatccttttgttattcacatgaagaagctcttgacaactggcttgatgagcccagtgctc
atcttagtggtgatttttccattccttagacccattcttgagggcctgaatttgaacttt
gttccaaacgatttcactcagttttttatgaatgctgtcacaagcttccgggagaagaga
aaaaaaggagatcactcgggacgtgtggatttacttcaacttatggtggattctaggaca
acagaaggaaatgatttaagcaatcagcacaaagctctgacagatgcagaaataatggct
caggcagttatctttatagttgctggatatgaaaccacaagtacagcactgtcttacctg
ttttattgccttgccacccaccctgatgttcagcagaggttgcatgaggaaatagattca
tttcttcctaacaaggccagtcctacttatgacattctgatgcagatggaatatcttgat
atggtcattcaggagaccctcaggttgtatccccctgcaggacgactagaaagagtctca
aagcagaatgttgagattaatggtgttagcatccccaaggggacagtcacaatgatccca
gcatatgtgctacagcgggaccctgagtattggccagagcctgaagagttccgccctgaa
aggttcagtaaagaaaacagggaaacccatactccatttacctttctgccttttggagat
ggtcccaggaattgcataggaatgagatttgctctcctgagcatgaaagtggctattgtc
accatgttacagaacttcagtgtccggccttgtgcagaaactctgattcccatggagttc
agcaccataggctttttacagccaaagaaaccaattgttttaaaatttctctctcggacg
tcagctcaagagtaa

DBGET integrated database retrieval system