KEGG   Xenopus laevis (African clawed frog): 100037189Help
Entry
100037189         CDS       T01010                                 

Gene name
cyp3a4
Definition
cytochrome P450, family 3, subfamily A, polypeptide 4
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:xla00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:xla00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:xla00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 504 aa AA seqDB search
MNLIPHLSTGTWILLAALFLLILLYGIWPYGFFKKMGIPGPTPLPFIGTFLEFRKGMVQF
DTECFKKYGKMWGTYDGRQPVLAVMDPAIIKTILVKEFYTNFTNRRNFGLNGPFEFAITI
AEDEQWKRIRSVLSPTFTSGKLKEMFQIMKDYSDILVKNIQGYVDKDEPCATKDVIGAYS
MDVITSTSFSVNIDSLNKPSDPFVIHMKKLLTTGLMSPVLILVVIFPFLRPILEGLNLNF
VPNDFTQFFMNAVTSFREKRKKGDHSGRVDLLQLMVDSRTTEGNDLSNQHKALTDAEIMA
QAVIFIVAGYETTSTALSYLFYCLATHPDVQQRLHEEIDSFLPNKASPTYDILMQMEYLD
MVIQETLRLYPPAGRLERVSKQNVEINGVSIPKGTVTMIPAYVLQRDPEYWPEPEEFRPE
RFSKENRETHTPFTFLPFGDGPRNCIGMRFALLSMKVAIVTMLQNFSVRPCAETLIPMEF
STIGFLQPKKPIVLKFLSRTSAQE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcattcctcacctgtcaacagggacatggattctcctggctgctctttttttg
cttatattactctatggcatttggccatatggattctttaagaaaatgggaattcctgga
cctactccattgccgttcataggaacatttctggaatttaggaaagggatggtacagttt
gatacagaatgcttcaaaaaatatgggaagatgtggggaacttatgatgggagacaaccc
gtgcttgcagtcatggaccctgctataattaaaactattcttgtgaaagagttttacaca
aatttcacaaacagacggaattttggtttgaatggcccctttgagtttgccatcactatt
gcagaggatgaacagtggaaaaggattcggagtgtgctctcacctacattcaccagtggg
aaactaaaagagatgttccagataatgaaagattactcagatatccttgtgaaaaacatc
cagggttatgtggacaaagatgagccatgtgcaacaaaggatgtgattggagcatacagc
atggatgtcatcaccagcacctcattcagtgtgaatattgactcccttaacaaaccatca
gatccttttgttattcacatgaagaagctcttgacaactggcttgatgagcccagtgctc
atcttagtggtgatttttccattccttagacccattcttgagggcctgaatttgaacttt
gttccaaacgatttcactcagttttttatgaatgctgtcacaagcttccgggagaagaga
aaaaaaggagatcactcgggacgtgtggatttacttcaacttatggtggattctaggaca
acagaaggaaatgatttaagcaatcagcacaaagctctgacagatgcagaaataatggct
caggcagttatctttatagttgctggatatgaaaccacaagtacagcactgtcttacctg
ttttattgccttgccacccaccctgatgttcagcagaggttgcatgaggaaatagattca
tttcttcctaacaaggccagtcctacttatgacattctgatgcagatggaatatcttgat
atggtcattcaggagaccctcaggttgtatccccctgcaggacgactagaaagagtctca
aagcagaatgttgagattaatggtgttagcatccccaaggggacagtcacaatgatccca
gcatatgtgctacagcgggaccctgagtattggccagagcctgaagagttccgccctgaa
aggttcagtaaagaaaacagggaaacccatactccatttacctttctgccttttggagat
ggtcccaggaattgcataggaatgagatttgctctcctgagcatgaaagtggctattgtc
accatgttacagaacttcagtgtccggccttgtgcagaaactctgattcccatggagttc
agcaccataggctttttacagccaaagaaaccaattgttttaaaatttctctctcggacg
tcagctcaagagtaa

DBGET integrated database retrieval system