KEGG   Xenopus laevis (African clawed frog): 100037210Help
Entry
100037210         CDS       T01010                                 

Gene name
ppt1
Definition
palmitoyl-protein thioesterase 1 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:xla01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:xla00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:xla04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 299 aa AA seqDB search
MAAWWALALTALVLTLNDGKAEADPVPLVIWHGMGDSCCNPFSMGAVKKMVETQIPGIYV
LSLKIGNSIPEDMENSFFLNVNEQVEGVCKELAQNPALKNGYNSMGFSQGGQFLRAVAQR
CPSPPMRNLISIGGQHQGVYGFPRCPGEISHMCDLIRKFLNLGAYTRDVQNHLVQAEYWH
DPINEEEYRNGSIFLADINQERHVNESYKKNLQLLEKFVMVKFLNDTMVDPPDTEWFGFY
KPGQSKETIRLQESSLYTEDRLGLKEMEKAGKLVFLGVEGNHLQFSQEWFNKNIIPFLH
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgtggtgggctcttgcgctgacagctctggttctgactctgaatgatgggaag
gcagaagcggacccggtaccgttagttatttggcacggaatgggagattcctgttgcaac
cccttcagcatgggggcagtgaagaaaatggtggagacgcagattccagggatatatgtt
ctttcactgaagattggcaacagcatcccagaggacatggaaaacagcttcttcctcaat
gtgaatgagcaggtggaaggtgtttgcaaagagctagcccaaaatcctgcactgaaaaat
ggatataacagtatgggattttctcaaggagggcaatttttgagagcagtggctcagaga
tgtccttctccacctatgaggaatctgatttctattggaggacaacatcaaggagtctat
ggatttccacgatgtccaggagaaatttcccatatgtgtgacttgataagaaagtttctg
aatcttggtgcctacactagagatgtacaaaatcacctggtgcaagctgaatattggcac
gacccaataaatgaagaggaatacagaaatggcagtattttcctagcagacatcaatcag
gagaggcatgtgaatgagagttacaaaaagaatctccaactgttggaaaagtttgtgatg
gtgaaatttcttaatgacaccatggtggatcctcccgatacagaatggtttgggttctac
aaacctggacaaagcaaagagactatcagattacaggaaagcagtttgtatactgaggat
cgtttggggcttaaggaaatggaaaaagcgggaaagctggtgtttctaggagtggaagga
aatcacctgcaattctcacaagagtggtttaacaagaatataattccctttctgcactga

DBGET integrated database retrieval system