KEGG   Xenopus laevis (African clawed frog): 100037216Help
Entry
100037216         CDS       T01010                                 

Gene name
hibch
Definition
3-hydroxyisobutyryl-CoA hydrolase (EC:3.1.2.4)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100037216 (hibch)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100037216 (hibch)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100037216 (hibch)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100037216 (hibch)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100037216 (hibch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 385 aa AA seqDB search
MSFGRLESQLRLKVFGRLQVIRQHLRMSNHTVKDGGCLLTKAGCAGVITLNRPKALNALN
LGMIRQIYPQLKLWEEDPETYLVIIKGAGGKAFCAGGDIRAVTDAGKVGDRLAQDFFREE
YILNNAIGTCKKPYVAVIDGITMGGGVGLSVHGHFRVASEKTLFAMPETAIGLFPDVGGG
YFLPRLTGKLGLYLALTGFRLKGSDVQKAGIATHFVESEKLSSLEQDLVAMKSPSKENVA
DVLDSYQKKSYAAQDKPFVLAENMDKINSLFSGNTVEEIMENLKCDGSSFAMKQLQTLST
MSPTSLKITFRQLKEGASMSLQEVLTMEYRLSQACMNGHDFYEGVRAVLIDKDQKAKWKP
ESLEEVTEDYIDSCFTSLGSRDLKL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagttttggacgtctagaatcgcagttaaggctgaaggtctttggcagactgcaagta
attcggcaacatttgagaatgtctaatcacacagtgaaagatggaggttgtctgcttaca
aaggctggatgtgcaggagtaattactttgaacagacctaaggcacttaatgccctaaac
cttggcatgatcagacagatttatcctcagttgaagctgtgggaagaagatcctgagacc
tatctggtaattattaaaggagctggtggcaaagcattttgtgcgggtggggacatcaga
gctgttacagatgcaggaaaagttggagacagacttgcacaagattttttcagagaagaa
tatattctaaacaatgctattggtacctgcaagaaaccttatgttgcagttatcgatggc
attacaatgggaggtggggtgggtctgtcagtccatggacatttcagagtagcatctgag
aagactctctttgcaatgcctgagacagcaatagggctctttcctgatgttggtggagga
tattttttgcctcgacttactgggaagctcggcttgtatcttgcgcttactggattccga
ttaaagggaagtgatgtacagaaggcaggaatagcaacccactttgttgaatcagaaaag
ctttcatcccttgaacaagatcttgttgccatgaagtccccttcaaaagagaatgttgct
gatgtgctggattcgtatcaaaaaaagagttatgctgctcaggacaagccatttgtactt
gcagaaaacatggacaagataaacagcttattctctggcaacactgtagaagaaatcatg
gaaaatctgaaatgtgacggctcttcttttgcaatgaaacagctccagacgctttccaca
atgtcaccaacatccttaaaaataacattccggcagctcaaggaaggtgcttccatgtca
ttacaagaagtacttactatggagtatcgcctcagccaggcctgcatgaacggacatgat
ttttatgaaggtgtaagagctgttttgattgacaaggaccagaaagccaagtggaagcct
gagtcattagaagaagtgacagaggattatatagatagctgtttcacatcccttggaagt
cgagacctcaagctgtaa

DBGET integrated database retrieval system