KEGG   Xenopus laevis (African clawed frog): 100037216Help
Entry
100037216         CDS       T01010                                 

Gene name
hibch
Definition
3-hydroxyisobutyryl-CoA hydrolase (EC:3.1.2.4)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:xla01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:xla00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:xla00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:xla00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 385 aa AA seqDB search
MSFGRLESQLRLKVFGRLQVIRQHLRMSNHTVKDGGCLLTKAGCAGVITLNRPKALNALN
LGMIRQIYPQLKLWEEDPETYLVIIKGAGGKAFCAGGDIRAVTDAGKVGDRLAQDFFREE
YILNNAIGTCKKPYVAVIDGITMGGGVGLSVHGHFRVASEKTLFAMPETAIGLFPDVGGG
YFLPRLTGKLGLYLALTGFRLKGSDVQKAGIATHFVESEKLSSLEQDLVAMKSPSKENVA
DVLDSYQKKSYAAQDKPFVLAENMDKINSLFSGNTVEEIMENLKCDGSSFAMKQLQTLST
MSPTSLKITFRQLKEGASMSLQEVLTMEYRLSQACMNGHDFYEGVRAVLIDKDQKAKWKP
ESLEEVTEDYIDSCFTSLGSRDLKL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagttttggacgtctagaatcgcagttaaggctgaaggtctttggcagactgcaagta
attcggcaacatttgagaatgtctaatcacacagtgaaagatggaggttgtctgcttaca
aaggctggatgtgcaggagtaattactttgaacagacctaaggcacttaatgccctaaac
cttggcatgatcagacagatttatcctcagttgaagctgtgggaagaagatcctgagacc
tatctggtaattattaaaggagctggtggcaaagcattttgtgcgggtggggacatcaga
gctgttacagatgcaggaaaagttggagacagacttgcacaagattttttcagagaagaa
tatattctaaacaatgctattggtacctgcaagaaaccttatgttgcagttatcgatggc
attacaatgggaggtggggtgggtctgtcagtccatggacatttcagagtagcatctgag
aagactctctttgcaatgcctgagacagcaatagggctctttcctgatgttggtggagga
tattttttgcctcgacttactgggaagctcggcttgtatcttgcgcttactggattccga
ttaaagggaagtgatgtacagaaggcaggaatagcaacccactttgttgaatcagaaaag
ctttcatcccttgaacaagatcttgttgccatgaagtccccttcaaaagagaatgttgct
gatgtgctggattcgtatcaaaaaaagagttatgctgctcaggacaagccatttgtactt
gcagaaaacatggacaagataaacagcttattctctggcaacactgtagaagaaatcatg
gaaaatctgaaatgtgacggctcttcttttgcaatgaaacagctccagacgctttccaca
atgtcaccaacatccttaaaaataacattccggcagctcaaggaaggtgcttccatgtca
ttacaagaagtacttactatggagtatcgcctcagccaggcctgcatgaacggacatgat
ttttatgaaggtgtaagagctgttttgattgacaaggaccagaaagccaagtggaagcct
gagtcattagaagaagtgacagaggattatatagatagctgtttcacatcccttggaagt
cgagacctcaagctgtaa

DBGET integrated database retrieval system