KEGG   Xenopus laevis (African clawed frog): 100049109Help
Entry
100049109         CDS       T01010                                 

Gene name
rae1, gle2, mig14, mnrp41, mrnp41
Definition
ribonucleic acid export 1
Orthology
K14298  
mRNA export factor
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100049109 (rae1)
Messenger RNA biogenesis [BR:xla03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100049109 (rae1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 368 aa AA seqDB search
MSLFSTPGGFGTGGGSMFGSTATDNHNPMKDIEVASPPDDSISCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDNGQTIPKAQQMHTGPVLDVCWSDDGTKVFTASCDKTAKMWDLNSNQS
IQVAQHEAPIKTVHWVKAPNYSCIMTGGWDKSLKFWDTRSPNPLLTLQLPERCYCADVVY
PMAVVATAERGLIVYQLENQPSEFRRIDSPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTTAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACSFNHNGNIFAYSSSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgttttccacccctgggggatttggaactgggggcggcagtatgttcggcagc
acagcgactgataaccacaatcctatgaaggacattgaagtggcatcacctccagatgac
agcatctcgtgcctctctttcagccccccaaccctgccgggcaacttcctgattgcagga
tcctgggccaatgatgtgaggtgctgggaagttcaagataatggacagaccattccaaaa
gcacaacagatgcacacaggccctgtgcttgacgtctgctggagtgatgacgggaccaaa
gtgtttacagcctcatgtgataaaactgccaaaatgtgggatcttaacagcaaccagtca
atacaagttgcacagcatgaagcccctataaagactgtgcattgggtaaaggctccaaat
tatagttgcatcatgactggtggctgggataaaagtttaaagttttgggacacaagatca
ccaaacccactgctgaccctacaactcccagaacgatgttactgtgctgatgtggtgtac
cctatggctgttgtggccactgcagagagagggttaatagtgtatcagcttgagaaccag
ccgtcggaattcagaagaatagactctcccctcaaacatcagcaccgctgtgtcgccata
tttaaagacaagcagaacaagccaacgggctttgcacttggaagtatagaaggaagagtc
gcaattcattacatcaaccctcccaatccagccaaagacaacttcacatttaaatgccac
cgctccaatggcacgaacacaacagcccctcaagatatatatgctgtaaatggcatcgct
ttccatcctgtacacggcactttggctacggttggctcagatggacgattcagtttctgg
gacaaagatgcccggaccaaactgaagacttcggagcagctggaccagccaatctctgct
tgttctttcaaccacaatggaaatattttcgcctattcttctagctatgactggtccaag
gggcatgaattctacaatccacagaagaagaactatatcttcttgcgtaacgccgctgaa
gaattgaaaccccggaacaagaaatag

DBGET integrated database retrieval system