KEGG   Xenopus laevis (African clawed frog): 100049134Help
Entry
100049134         CDS       T01010                                 

Gene name
clk1
Definition
CDC-like kinase 1 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 462 aa AA seqDB search
MNHSNRSKCPGEEERHFSKCYKRKRSQSSEEEREFRKKISSESYYKEDKSTSDRGRHDRR
YVELRNNYRGADHDQKHHNRYSKSSGQSSSSSSHKKRHRKHHHSRHTSPSKSHRRKRSRS
VEDDEEGHLICESGDVLRERYEIVHNVGEGAFGKVVECIDLTGSGKRVAVKIIKNVERYR
EAAQSEIKVLEHLSRKDPKNTFRCVQMLEWFDHHGHVCIVFELLGLSTYDFIKENSFLPF
PMDQIRNMAYQICKSINFLHQNQLTHTDLKPENILFVHSDYVVNFNPTKKRDERYLKNSD
IKIVDFGSATYNHEYHSALVSTRHYRAPEVILELGWSQPCDVWSIGCILIEYYLGLTVFQ
THDSKEHLAMMERILGPLPLHMIQKTRKHKYFYHDRLDWDEHSSAGRYVKKRCKPLKEYM
VSDNKDHHQLFDLIRRMLEYDPAKRITLEEAMKHPFFELLKF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacagcaaccgaagtaaatgccctggcgaggaggagcggcatttcagcaagtgc
tacaaaagaaaaagatcacaaagcagcgaggaagaaagagaattccgtaaaaagatctca
tcagagagctactataaagaagacaagtctacgagtgatcgaggtcggcatgacagacga
tacgtggaactgagaaataactacaggggtgcagatcatgaccaaaaacatcataacaga
tacagcaagtcatctgggcaaagcagcagcagcagcagtcacaaaaagcgacatagaaaa
catcaccattcaagacacacttcaccttcgaagagtcatcgaaggaaaagatccagaagt
gtagaggatgatgaggagggtcatctgatctgtgaaagtggagacgtactaagagaaaga
tatgaaattgtgcataatgtgggagaaggagcttttggaaaagtagtggaatgcattgat
ctaactgggagtggtaagcgagtagccgtgaaaatcatcaaaaatgtggaaagatatcgg
gaagctgcccagtccgaaattaaagttttggagcatttgagcagaaaagatcccaaaaac
acttttcggtgtgttcagatgctggagtggtttgatcaccatggccacgtttgcatcgtt
tttgaacttctgggactaagtacctatgattttataaaagaaaatagcttcttgcctttt
cctatggatcaaataagaaacatggcatatcagatctgtaaatctattaactttttacat
caaaaccagctgacccatacagatctgaaaccagaaaatattctctttgtccattctgat
tatgtagtcaattttaatcctacaaagaaaagggatgagcgctatttaaaaaatagtgat
attaaaattgtagactttggaagtgctacgtacaaccacgaatatcacagtgctttggtt
tctacaagacactacagggctccagaagttatattggaattaggttggtcccagccttgt
gatgtatggagcataggttgtattctaattgaatactaccttggtctaactgtgtttcag
actcatgacagcaaagaacacctcgcaatgatggaacgaatactgggaccgttaccactc
cacatgattcagaaaacgagaaaacacaagtatttttatcatgatcgtctggattgggat
gaacatagttctgctggccgatatgttaagaaacgttgtaagccattgaaggaatacatg
gtttctgacaacaaggatcatcatcagttatttgatcttatccgaagaatgttggagtat
gaccctgctaaaagaataacgcttgaagaagcaatgaaacatccattttttgaactgtta
aaattttag

DBGET integrated database retrieval system