KEGG   Xenopus laevis (African clawed frog): 100049134Help
Entry
100049134         CDS       T01010                                 

Gene name
clk1
Definition
CDC-like kinase 1 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100049134 (clk1)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100049134 (clk1)
Spliceosome [BR:xla03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100049134 (clk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 462 aa AA seqDB search
MNHSNRSKCPGEEERHFSKCYKRKRSQSSEEEREFRKKISSESYYKEDKSTSDRGRHDRR
YVELRNNYRGADHDQKHHNRYSKSSGQSSSSSSHKKRHRKHHHSRHTSPSKSHRRKRSRS
VEDDEEGHLICESGDVLRERYEIVHNVGEGAFGKVVECIDLTGSGKRVAVKIIKNVERYR
EAAQSEIKVLEHLSRKDPKNTFRCVQMLEWFDHHGHVCIVFELLGLSTYDFIKENSFLPF
PMDQIRNMAYQICKSINFLHQNQLTHTDLKPENILFVHSDYVVNFNPTKKRDERYLKNSD
IKIVDFGSATYNHEYHSALVSTRHYRAPEVILELGWSQPCDVWSIGCILIEYYLGLTVFQ
THDSKEHLAMMERILGPLPLHMIQKTRKHKYFYHDRLDWDEHSSAGRYVKKRCKPLKEYM
VSDNKDHHQLFDLIRRMLEYDPAKRITLEEAMKHPFFELLKF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacagcaaccgaagtaaatgccctggcgaggaggagcggcatttcagcaagtgc
tacaaaagaaaaagatcacaaagcagcgaggaagaaagagaattccgtaaaaagatctca
tcagagagctactataaagaagacaagtctacgagtgatcgaggtcggcatgacagacga
tacgtggaactgagaaataactacaggggtgcagatcatgaccaaaaacatcataacaga
tacagcaagtcatctgggcaaagcagcagcagcagcagtcacaaaaagcgacatagaaaa
catcaccattcaagacacacttcaccttcgaagagtcatcgaaggaaaagatccagaagt
gtagaggatgatgaggagggtcatctgatctgtgaaagtggagacgtactaagagaaaga
tatgaaattgtgcataatgtgggagaaggagcttttggaaaagtagtggaatgcattgat
ctaactgggagtggtaagcgagtagccgtgaaaatcatcaaaaatgtggaaagatatcgg
gaagctgcccagtccgaaattaaagttttggagcatttgagcagaaaagatcccaaaaac
acttttcggtgtgttcagatgctggagtggtttgatcaccatggccacgtttgcatcgtt
tttgaacttctgggactaagtacctatgattttataaaagaaaatagcttcttgcctttt
cctatggatcaaataagaaacatggcatatcagatctgtaaatctattaactttttacat
caaaaccagctgacccatacagatctgaaaccagaaaatattctctttgtccattctgat
tatgtagtcaattttaatcctacaaagaaaagggatgagcgctatttaaaaaatagtgat
attaaaattgtagactttggaagtgctacgtacaaccacgaatatcacagtgctttggtt
tctacaagacactacagggctccagaagttatattggaattaggttggtcccagccttgt
gatgtatggagcataggttgtattctaattgaatactaccttggtctaactgtgtttcag
actcatgacagcaaagaacacctcgcaatgatggaacgaatactgggaccgttaccactc
cacatgattcagaaaacgagaaaacacaagtatttttatcatgatcgtctggattgggat
gaacatagttctgctggccgatatgttaagaaacgttgtaagccattgaaggaatacatg
gtttctgacaacaaggatcatcatcagttatttgatcttatccgaagaatgttggagtat
gaccctgctaaaagaataacgcttgaagaagcaatgaaacatccattttttgaactgtta
aaattttag

DBGET integrated database retrieval system