KEGG   Xenopus laevis (African clawed frog): 100101276Help
Entry
100101276         CDS       T01010                                 

Gene name
prkaca.S, prkaca, prkaca.L
Definition
(RefSeq) protein kinase, cAMP-dependent, alpha catalytic subunit S homeolog
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04020  Calcium signaling pathway
xla04114  Oocyte meiosis
xla04140  Autophagy - animal
xla04261  Adrenergic signaling in cardiomyocytes
xla04270  Vascular smooth muscle contraction
xla04310  Wnt signaling pathway
xla04340  Hedgehog signaling pathway
xla04371  Apelin signaling pathway
xla04530  Tight junction
xla04540  Gap junction
xla04910  Insulin signaling pathway
xla04912  GnRH signaling pathway
xla04914  Progesterone-mediated oocyte maturation
xla04916  Melanogenesis
Module
xla_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100101276 (prkaca.S)
   04310 Wnt signaling pathway
    100101276 (prkaca.S)
   04340 Hedgehog signaling pathway
    100101276 (prkaca.S)
   04371 Apelin signaling pathway
    100101276 (prkaca.S)
   04020 Calcium signaling pathway
    100101276 (prkaca.S)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100101276 (prkaca.S)
  Cell growth and death
   04114 Oocyte meiosis
    100101276 (prkaca.S)
  Cellular community - eukaryotes
   04530 Tight junction
    100101276 (prkaca.S)
   04540 Gap junction
    100101276 (prkaca.S)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100101276 (prkaca.S)
   04912 GnRH signaling pathway
    100101276 (prkaca.S)
   04914 Progesterone-mediated oocyte maturation
    100101276 (prkaca.S)
   04916 Melanogenesis
    100101276 (prkaca.S)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100101276 (prkaca.S)
   04270 Vascular smooth muscle contraction
    100101276 (prkaca.S)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100101276 (prkaca.S)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: AGC group
  PKA family
   100101276 (prkaca.S)
Messenger RNA biogenesis [BR:xla03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100101276 (prkaca.S)
Chromosome and associated proteins [BR:xla03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100101276 (prkaca.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 100101276
NCBI-ProteinID: NP_001093339
Xenbase: XB-GENE-6251955
UniProt: Q90WN3
Position
3S
AA seq 351 aa AA seqDB search
MGNAATTKKGGEIESVKEFLAKAKEDFLKKWESPAQNTANLDQFERMKTLGTGSFGRVML
VRHKENGSHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNTNLYMV
MEYVAGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVTDIKGHKWFST
TDWIAVYQKKVEAPFIPKCKGPGDTSNFDDYEEEEIRVSITEKCAKEFSDF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgcggctaccacaaagaagggtggcgagattgaaagtgtgaaagaatttctg
gcaaaagcaaaagaagattttctgaaaaaatgggagagtccagcacagaacacagcaaat
ctggaccagtttgagcgaatgaaaactcttggcaccgggtcgtttgggcgcgtaatgctg
gtcaggcacaaagaaaatggcagtcactttgctatgaaaatcttggacaagcagaaggtg
gtgaagttgaagcagattgagcacacgttgaatgagaaacggatactgcaggctgtgaat
ttcccattccttgtgcggctggagtattcgtttaaggataacaccaatctgtatatggtc
atggagtatgtagccggcggggagatgttctctcatttgcgcagaatcgggcgcttcagt
gaacctcatgcacgcttctatgcatcccagattgtattaactttcgaatatctacacgcc
ctggatcttatatacagagacttgaagccagagaatcttctcatagaccagcaggggtat
atccaggtgacagattttggatttgcaaagagagtgaaagggaggacctggaccctgtgt
gggacaccagaataccttgcgccagaaataatccttagcaagggttataataaggcagtg
gattggtgggccctaggagtcctgatttatgagatggctgctgggtatcctccatttttc
gctgatcagcccattcagatctatgaaaaaatagtatcggggaaggtccggttcccctct
cactttagctccgacctgaaggatcttctcagaaatcttttgcaagttgatctgactaag
cgttttgggaatttgaagaacggtgtcacagacatcaagggacacaaatggttcagtaca
acggactggattgcagtctaccagaaaaaggtggaagctcccttcatccctaaatgtaag
ggtcctggagacaccagtaattttgacgactatgaagaagaagaaatcagagtttcaatc
actgaaaaatgcgctaaagaattctctgacttttaa

DBGET integrated database retrieval system