KEGG   Xenopus laevis (African clawed frog): 100158367Help
Entry
100158367         CDS       T01010                                 

Gene name
glb1l
Definition
galactosidase, beta 1-like
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100158367 (glb1l)
  Lipid metabolism
   00600 Sphingolipid metabolism
    100158367 (glb1l)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100158367 (glb1l)
   00604 Glycosphingolipid biosynthesis - ganglio series
    100158367 (glb1l)
   00511 Other glycan degradation
    100158367 (glb1l)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100158367 (glb1l)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100158367 (glb1l)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100158367 (glb1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 645 aa AA seqDB search
MMWLWATLRIFLMVVVYGSVSTTSSRTFEIDFEHNCFRKDGQPFHYISGSIHYSRIPQFY
WKDRLLKMKMAGLDAIYTYVPWNFHETKPGVYNFSGDHDIESFLKLANEIGLLVILRAGP
YICAEWDMGGLPAWLLAKESIVLRSSDPDYLQAVDNWMGVFLPKMKPLLYHNGGPIISVQ
VENEYGSYFTCDYNYLRHLLQLFRHHLGDEVILFTTDGSALQLVRCGTIQGLYTTVDFGP
GSNITETFLVQRHCEPKGPLINSEFYTGWLDHWGEPHSVVATERVTKSLDEILAIGASVN
MYMFIGGTNFGYWNGANTPYAPQPTSYDYDAPLSEAGDLTDKYFAIREVIKKYKEIPEGP
IPPSTPKYAYGEIKMEKVKPVIEALDILAPYGAVQSTYPLTFDQMKQYFGFVLYRTTLPI
NCSNPTTLTTLFNGVRDRAYVMVNGVPQGVLERDKQTAINVTGAAGAELDLLVESMGRVN
FGRYNNDFKGLLTNVTLNGETLVNWTMYPLDIGSAINSGLLSTIHSPYTSTFSAPTFYKG
SLIIPTGIPQLPQDTFIQFPGWTKGQIWINGFNLGRYWPVRGPQVTLYVPRNILTTTQIN
NITVLELENSPCNSGKCVVEFVDKPVLNKVNQSADEHIFSKEKIH
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggctgtgggcgactttacgcatttttctaatggtggttgtatatggctcagtc
agcacaacatcctcaagaacgtttgagatagattttgagcacaattgttttcgtaaagat
gggcagcctttccattacatttcaggaagtattcattattctagaattccacaattttat
tggaaagaccgcctactgaagatgaagatggcaggattagatgctatttacacttatgta
ccatggaatttccatgagacaaagccaggtgtttacaacttttctggagatcatgatatt
gagtcattcttgaaacttgcaaatgaaattgggctgctggtgatcctgagagcaggtcct
tacatatgtgcagaatgggacatgggaggtttgccagcatggcttctagcaaaagaatca
attgtccttcgaagttctgatccagattatcttcaggctgtggataattggatgggagtg
tttttgcccaagatgaaacctttgttgtatcacaatggcggcccaattataagtgtccag
gttgaaaatgagtatggcagctattttacttgtgattacaattatctacgacatctctta
caacttttccgccatcacttaggggacgaggtgattttattcacaactgatggctctgcg
ctacagcttgtaaggtgcggaactattcaaggcttatacacaacagtagattttggacca
ggttccaatattactgaaacatttttagttcaaagacactgtgagccaaaaggaccattg
attaactcagaattctacacagggtggttggatcactggggcgagccacactctgtagta
gcaacagagagggtaaccaagtcactggatgaaatcttggccattggagcaagtgttaac
atgtatatgtttataggaggcaccaattttggctactggaatggtgccaacacaccgtat
gcaccacagccgaccagttatgattatgacgcccctttatcagaagctggggatttgact
gataaatattttgccatcagagaagttataaaaaagtataaggagataccagagggtcct
attccaccatcaacacccaaatatgcatatggagaaattaaaatggagaaggtgaaacca
gttattgaggctttggatatattggccccatatggagcagtacagagtacttatcctcta
acatttgatcaaatgaaacagtattttggctttgtgctgtatagaacaacgttacctata
aattgcagtaatccaacaacactgactacgttatttaacggagttcgggaccgtgcctat
gttatggttaatggggttccacaaggtgttcttgaaagagataaacagactgccataaat
gtaactggagcagcgggagcagaactggacttgctggtggaaagtatgggcagggttaat
tttggaagatacaataatgattttaagggtttgcttaccaatgtaaccctcaatggagag
acgctagtgaactggacaatgtaccctctagacataggtagtgctattaatagtgggctt
ttgtccaccattcatagtccatatacgtccaccttttcagctccgacgttttacaaaggc
agcctaattattcccactggaattccacaattaccccaggatacctttattcaatttcca
ggatggacaaaaggacagatatggatcaatggatttaacctggggcggtactggccagta
agaggtcctcaggttaccttgtatgttcccaggaacattttaacaacaactcaaattaac
aacattactgtactagagctggaaaattctccttgcaacagtggaaaatgtgttgtggag
tttgtggacaagccagttctcaataaagtaaatcaatctgctgatgaacacatattcagc
aaagaaaaaattcactaa

DBGET integrated database retrieval system