KEGG   Xenopus laevis (African clawed frog): 100158421Help
Entry
100158421         CDS       T01010                                 

Gene name
ache, arache, n-ache
Definition
acetylcholinesterase (Yt blood group) (EC:3.1.1.7)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100158421 (ache)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100158421 (ache)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 600 aa AA seqDB search
MALVPFAQLCLCTFSLLLSPALTQSDAGLQVTTHSGKVRGLRLPVLSSQVSAYLGIPFAE
PPVDKMRFRRSEPKKPWTDVWDATAYPDACYQYFDTLYPGFPGMEMWNPNRPMSEDCLYL
NIWVPHPRPSNATVMVWIYGGGFYSGSSSLDVYDGRYLCHAENVIVVSMNYRVGAFGFLT
LTPGSVDAPGNVGLFDQRLALQWVQDNIAFFGGDPRTVMIFGESAGAVSVGMHVISPGSH
HLFSKAALQSGTPNTPWATITPQEARRRTEMMGKKLDCRMGNDTELLNCLRAKQPQELID
HEFSVLPAPSVFRFAFVPVPDGDFFPEPPEVLMNMGRFKPCPLLMGVNQNEGSYFLLYGA
PGFSKNNESLINREEFLGGVKMSVPHANDIALEAVVMQYTDWADEHAGIKNREAMDQLVG
DHNVICPLTYFAGKASETGNRVYTYYFDHRASNLAWPQWMGVPHGYEIEFVFGLPLVANL
NYNPQEEALSRKMMRYWANFARTGDPNEGNDARQQRWPLYTASEQRYIALNNRPQQDLQG
IRVQTCMFWNRFLPKLLNITDNVDEAERQWKEEFHRWSTYMMRWKNQFDHYSKQERCSEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgtaccctttgctcagctgtgcctctgcacattctctctcctcctgtccccg
gctctcacacagagcgatgctggtctccaggtcactactcattctgggaaggtgcgtggc
ctcaggcttccagtcctttctagccaagtaagtgcctacctgggcattccctttgccgaa
ccaccagtggacaaaatgcgcttccgacgttcagaacccaagaaaccatggacagatgtt
tgggatgcaaccgcctatcctgatgcctgctatcaatattttgacactttgtatcctggt
tttcctggcatggaaatgtggaatcctaaccggccaatgagtgaagattgcctatatctt
aacatctgggtaccacatccacgtccctccaatgctaccgttatggtatggatatatggt
ggaggtttctacagtgggtcttcttcccttgatgtttatgatggacgctacctgtgccat
gcagaaaatgtcattgtggtctccatgaattaccgcgttggagcttttggttttctgacc
ctgacacccggtagtgttgatgctcctggcaatgttggattgtttgaccaacgtcttgct
ctccagtgggttcaggacaatattgctttctttggtggcgatcccaggactgtcatgatt
tttggggaaagtgctggtgccgtctctgtgggtatgcacgttatttcccctggaagccac
catctcttttccaaggctgcattgcagagtggcacacccaacacaccctgggctacaatc
accccacaagaagctagacgccgcacagagatgatgggaaaaaaattggactgcagaatg
ggaaatgatacagagttattgaactgtctaagagccaagcaaccccaggaattaattgat
catgaattctctgtccttccagcacccagtgtctttcgttttgcctttgtgccggtgcca
gatggagacttttttccagagcctcctgaggtcttgatgaatatgggcagatttaagcca
tgccccttgctgatgggagtcaaccaaaatgaaggctcatacttcctactgtatggggcc
cctggctttagtaagaacaacgagagtctcatcaatcgagaagagttcctcggtggggtc
aagatgagtgttccacatgccaacgatattgccctggaggcagtagtgatgcagtacaca
gactgggcagacgagcatgcaggaatcaagaacagagaggccatggatcagctggtggga
gaccataatgtcatttgccccctcacttattttgccgggaaggcctcagagactggaaac
cgggtgtatacttattattttgatcaccgggcatccaacttggcttggccacagtggatg
ggggttccacatggatacgaaattgaatttgtcttcggtcttcccctagttgcaaatctg
aactataacccacaggaagaggctctgagtcgcaagatgatgagatattgggctaacttt
gcacggactggtgaccctaacgagggtaacgatgcccgtcaacagcgttggcccttgtac
actgcatccgagcagaggtatatagcacttaacaacaggccacaacaggatctgcagggc
atccgagtccaaacgtgcatgttctggaatcgtttcttgcctaaactgctcaacattaca
gacaatgttgatgaggctgagcggcagtggaaagaggagttccatcgctggagcacctac
atgatgagatggaagaaccagtttgaccattacagtaagcaggagcgatgcagcgagctg
tga

DBGET integrated database retrieval system