KEGG   Xenopus laevis (African clawed frog): 100158436Help
Entry
100158436         CDS       T01010                                 

Gene name
usp20
Definition
ubiquitin specific peptidase 20 (EC:3.4.19.12)
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 840 aa AA seqDB search
MADAEDFCPHLDSIGEVTKEDLILKSKGTCESCGVGGPNLWACLQDGCQSVGCGESYADH
STLHAQDFPSPAHPLKSVPIAVGDDGESESDEDDIKPRGLTGMKNIGNSCYMNAALQALS
NCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSELWHKKRPSYVVPSSLYHGIKLINPLF
RGYSQQDTQEFLRCLMDQLHEELKEPILPENQEQEEEERDDQREGERGGTTEEDFLSCDS
GGEMGDGEGGGGVGTLSEMELLIREEVGRGLSEKEKLKERKLSYCHRRTSSEQADEDADV
DTAMIPEPDNDAYMHCSSRSCSPHPVESISKHSSTPPRSSPLRTAHSYVLKKAQVLSGGK
KRSEVRYRSVISDIFDGSILSLVQCLTCDRVSTTIETFQDLSLPIPGKEDLAKLHSTIHQ
STVIKAGTCGDSYAAQGWLAFVMDYIRRFVVSCIPSWFWGPMITLEDCLAAFFAADELKG
DNMYSCERCKKLRNGVKYCKVLRLPEVLCIHLKRFRHEVMYSFKIGSHVSFPLEGLNLRP
FLAKECVSRITTYDLLAVICHHGSASSGHYISYCQNVINGQWYEFDDQYVTEVHETVVQN
AEAYVLFYRKSSEEAERERQKVVSLAAMKESGLLQFYISREWLNKFNTFAEPGPISNQSF
LCAHGGIPPNKYHYIDDLVVILPQSVWEYLYNRFGGGPAVNHLYVCSICQVEIEALAKRR
KTEIDTFIKLNKAFQAEEAPSVIYCISMQWFREWEAFVKAKDSDPPGPIDNSKVALTKSS
GHVQLKQGADYGQISEETWNYLLNIYGGGPEIAIRQTVAQYQDPEHLHGEQKIEAETRAG
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgccgaggatttctgccctcacctggactccattggagaagttaccaaggaa
gatcttatcttgaaatccaagggaacgtgtgagtcgtgcggcgtgggaggacccaaccta
tgggcctgtctgcaggatggctgccagtctgtgggatgcggcgagtcgtatgctgatcat
agtaccctgcatgcacaggacttcccttctcctgctcatccactgaagtctgtccccatt
gctgttggagatgatggcgagtcagagagtgatgaagacgacatcaagccacgaggactc
acgggaatgaaaaacattggcaactcctgctacatgaatgcggccctccaggctctgtcc
aactgtcctcccctgacgcagttctttctggagtgtgggggattagtccggacagacaag
aagccagcactgtgcaaaagttaccagaaactcgtctctgagctgtggcacaagaagcgg
ccaagttatgtggtgccctccagcttgtaccatgggatcaaactgattaaccctctgttc
cggggttattcccaacaggacacccaggagtttctccgctgcctgatggaccaactccat
gaggaactgaaggaacccatcctgcctgagaaccaggaacaggaagaagaggaaagggac
gatcaacgagagggggaacgaggcggcacaacggaggaggacttcctgtcgtgcgattct
ggtggcgagatgggggacggggagggtggaggaggcgtgggcacattgtccgagatggag
ctgctaatccgggaggaagttgggagggggctctctgaaaaggagaagttgaaggaaagg
aagctgtcatattgtcacagaaggacaagctcagagcaggcagatgaggatgcagatgtg
gacacagcaatgattccagagcctgataatgacgcctacatgcactgctcctctcggtcc
tgcagcccacacccagtggaatccatctccaagcactctagcacccctcctcgctccagt
ccactgcgcaccgcccattcctacgtcttaaaaaaagctcaagttctgagtggaggaaag
aaacgctccgaagtccgatatcgaagcgttatttctgatatcttcgatgggtctatactg
agtctggtccagtgtctgacctgcgacagggtctctactactattgagaccttccaggac
ctttccctgcccatccctggaaaagaggacctggcaaagttacactccaccatccaccag
agcactgtcattaaggctggcacttgcggggatagctatgctgcccagggctggctggcc
ttcgttatggactacatacgcagatttgtggtttcttgcatcccaagctggttctggggt
cccatgataacgctggaggattgcctggctgctttctttgctgctgatgaattaaaaggt
gataacatgtacagttgtgagcgctgtaagaagcttagaaatggcgtgaaatactgtaaa
gttttacgtctgccggaggttctgtgcattcacctgaaacgtttccggcacgaagtcatg
tactcctttaaaattggcagccatgtttcattccctctggaggggcttaatctgagaccc
ttcctggctaaagaatgtgtttcccgtatcacgacttatgatctcttggctgttatttgc
caccacggcagtgccagcagtgggcactatatatcttattgccagaatgtgatcaacgga
cagtggtacgagtttgacgatcagtacgtcacggaggtgcacgagacagtggttcagaat
gcagaggcctatgttctcttctacaggaagagcagcgaggaggctgagcgggagaggcag
aaggtggtgtccttggcagccatgaaagagtcgggcctcctgcagttctacatctcccgc
gagtggcttaacaagttcaacacgtttgcagaacctggaccaataagcaaccaaagtttc
ctatgtgcacatggagggattccccccaacaaatatcattatattgatgatctggtggtg
attctcccgcagagtgtgtgggaatatctatataacaggtttggaggtggacccgcagtg
aatcacttgtacgtctgctccatctgtcaggtggagatcgaggccttggcgaaacgcaga
aagacagagattgacactttcattaagctgaataaagcattccaagcagaagaagccccc
agtgtgatatactgtatcagcatgcagtggttccgggagtgggaagcctttgttaaagcc
aaggacagtgaccctcccggcccaattgataacagcaaagtggcacttaccaagagtagc
gggcacgtgcagctgaaacagggcgctgattacgggcagatttcggaggagacgtggaat
tacctgttgaacatatatggaggcgggccagagatcgcaatccgccagacggtggcgcag
tatcaggatccggaacatctgcacggagagcagaagattgaagcagagacacgggccggg
tag

DBGET integrated database retrieval system