KEGG   Xenopus laevis (African clawed frog): 100158454Help
Entry
100158454         CDS       T01010                                 

Gene name
cdc25b-a, cdc25b, cdc25ba
Definition
cell division cycle 25B
Orthology
K05866  
M-phase inducer phosphatase 2 [EC:3.1.3.48]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Cell cycle
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100158454 (cdc25b-a)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100158454 (cdc25b-a)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100158454 (cdc25b-a)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100158454 (cdc25b-a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 562 aa AA seqDB search
MELEKLLNDFSPSRSDLPVPRPTRLPGLPCAIVATRGLLCQESGVLSPVTSLAFTMNKLA
GLGSQNETPKRKLGISFQAQCTSLLRTSSSDSSDSGLCLDSPSPQELEVTHETFGKVMFE
SRILPNDVKLPIKRIHSLPETLQGGSPALRKLPHTLDLDLPKPLEKIPAEKDNKENELLL
FKRPRPFCRARLRTFDGFNDRDAFSERPNSAPALMLFSPDKINSELDNESPIRLRKSSLT
FSLCNDDDDDDGFMEIMDDEDIKTDIPSGMQNLLTAPFVNKEDKNDADTIIRSKCRRLFR
SPSMPSSVIRPILKRLDRPEDGDTPVKSKRLKNLPQSHSEEWPENEEPKMKLGRSKSVCL
ATVEKILDNDERELIGDSSKAFLLKTVEGKHQDLKYITPETMDSVLSGRYDGVIDRCVII
DCRYPYEYEGGHIKGALNLPLEQDVEDFLLKKPILPESPDKRVIVIFHCEFSSERGPRMC
RFVRKQDRNSNEYPKLHYPELYVLKGGYKDFFPTFQSHCEPQSYRPMHHEDFKEHLKMFR
SKSRTWAGDKSKREMYNRLKNQ
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggagttggagaagctgctgaatgatttcagtcccagccggagtgacctccctgtgccc
agacccacccgcctgccaggcttgccctgtgccattgtggctaccagggggctactgtgc
caagaatctggggtcttgtcccctgtcaccagcctggctttcaccatgaacaaactggcc
ggcctgggaagccaaaatgagacaccaaaaagaaaacttggcatttccttccaggctcag
tgcacctccctgttgcgcacgtcatcttctgattcgtccgattccggtctctgcttggat
tcccccagcccccaagaattggaggtcacccacgaaacgtttggaaaggttatgtttgaa
tcaagaatccttcccaatgatgtcaagctgccaatcaaaagaatccactccttgccggag
actctccaggggggcagccctgctctaagaaaactcccccatactttggacctggatctg
cccaaaccccttgagaagatcccagcggagaaggacaataaggagaatgaattactcctc
ttcaagaggccgcgcccgttctgccgtgccaggctccgcacttttgatggcttcaacgac
agggacgcgttttccgaaaggcccaactccgccccagctctcatgcttttcagtccggac
aagatcaactctgagctggacaacgaaagtcccatccgcttacgcaaatcctccctgacc
ttctctctgtgcaatgatgatgacgatgatgatggattcatggaaattatggatgatgaa
gatataaagactgatatcccctctggaatgcagaatctgcttactgcaccgtttgtgaac
aaagaagacaagaatgacgctgatacgattattagaagcaaatgccgccggctgttccgt
tcgccctctatgcctagtagcgtcatcaggcctatcctgaaacggttggacagaccagaa
gatggtgacactcccgtgaagtcaaaaaggctgaagaacttaccgcagtcgcactcggaa
gaatggccagagaatgaggagccgaaaatgaagttgggaaggtccaagtctgtatgtctt
gctactgtggagaagatactggacaatgatgagagagagctcattggtgactcctcaaag
gcctttttactgaaaacagtggaagggaagcatcaggatctgaaatacatcactccagaa
acgatggacagtgtgctgagcgggaggtacgacggtgtgattgaccgttgcgtgattatc
gattgccgatacccttatgaatacgaaggggggcacatcaagggagccttaaacctcccc
ctggagcaggacgtggaagactttctgctgaagaaacccatactaccggagagccccgac
aagcgagtgatcgtaatattccactgcgaattctcctcagagaggggccccaggatgtgc
cgatttgttagaaagcaagaccgcaatagtaacgagtaccccaaactacactacccagaa
ctttatgtccttaaaggaggctacaaggatttctttcccacctttcagtcccattgtgag
cctcagtcctacaggccgatgcaccacgaggacttcaaagagcacctgaagatgttccgt
tccaagagtcggacctgggccggagacaagagcaagcgagagatgtacaaccgcctgaag
aaccagtag

DBGET integrated database retrieval system