KEGG   Xenopus laevis (African clawed frog): 100189579Help
Entry
100189579         CDS       T01010                                 

Gene name
tpm1, CH1, alpha-tm, alpha-tropomyosin
Definition
tropomyosin 1 (alpha)
Orthology
K10373  
tropomyosin 1
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xla00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100189579 (tpm1)
   04261 Adrenergic signaling in cardiomyocytes
    100189579 (tpm1)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100189579 (tpm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKGAEDKSKQLEDELVALQKKLKGTEDELDKY
SEALKDAQEKLELSDKKATDAEGDVASLNRRIQLVEEELDRAQERLSTALQKLEEAEKAA
DESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAE
ERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAE
FAERTVAKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctcaaactggacaaggaaaatgccttggac
agagcggaacaggctgaagcagacaagaagggagcagaggacaagagcaaacagctggag
gatgaacttgtagcattgcagaagaaactaaaaggtactgaggatgagctggacaaatac
tctgaagccctgaaagatgcccaggagaagctagaactttccgacaagaaagccactgat
gctgaaggagatgtagcctcattgaacaggcgcattcaactggtagaggaggagttggat
cgtgctcaggagcgtctgtccacagctcttcagaaactggaggaggctgagaaggctgca
gatgagagtgagagaggtatgaaggtcattgaaaacagagccctgaaggatgaagagaaa
atggagctgcaagaaatccagctgaaagaggccaagcacattgctgaggaggctgaccgc
aaatatgaagaggtcgctcgtaagctggtgatcattgagggtgatctggaacgtgcagag
gaacgtgctgaactttcagaaagcaaatgtgccgagcttgaggaggaacttaaaactgtt
acaaacaacctgaaatctctggaggcccaggcagagaagtactcccagaaggaggacaaa
tatgaagaggaaattaaggttcttacagataaactgaaggaggctgaaacacgtgctgag
tttgcagagaggacagtagccaagttggaaaagtccattgatgatttagaagatgagctg
tatgctcagaaactgaagtacaaagccatcagtgaagaactggatcacgctctcaatgac
atgacttcaatataa

DBGET integrated database retrieval system