KEGG   Xenopus laevis (African clawed frog): 100294517Help
Entry
100294517         CDS       T01010                                 

Gene name
gria4, glur4
Definition
glutamate receptor, ionotropic, AMPA 4
Orthology
K05200  
glutamate receptor 4
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100294517 (gria4)
Ion channels [BR:xla04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   100294517 (gria4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 902 aa AA seqDB search
MRMIYQQMLLVFSGFWGLVMGAFPGSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNESEA
LFNLVPHVDNIETSNSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPPLRGALLSLLDHYGWNHYVFLYDTDRGYSILQAIMEKAGQNGWQ
VSAICVENFNDASYRRLLEDLDRRQENKFVIDCEVERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLDRFMHGGANVTGFQLVDFNTPIVTELMQRWKTLDQREYPGSESPPKYTSAL
TYDGVLVMAEAFRILRRQKVDLSRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
IQFDHYGRRVNYTMDVLELKSNGLRKIGYWNDMDKLVLLQHEPAFKNDSSGIENRTVIVT
TILESPYVMYKKNHELLEGNDKFEGYCVDLAYEIAKHIGIKYKIAIVPDGKYGARDSETK
IWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDAGSTKEFFKRSKIAVYEKMWTYMKSAEPSVFTKTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKHSQLGNAVNLAVLKLNEQGL
LDKLKNKWWYDKGECGGGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSIGENGRVLTPDCPRAVHTGTALRQSSGLAVIASD
LP
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgcggatgatttaccagcagatgctcctggtcttctctggcttttgggggcttgtgatg
ggggcctttcctggcagcgtccaaataggtggacttttcattcgaaacacagatcaggaa
tataccgcttttcggttggcgatttttctccataacaccagccccaatgaatcggaagca
ctttttaatttggttcctcatgtggataacatagaaacatccaacagcttcgctgtcacc
aatgccttttgctcccagtattcaagaggagtttttgccatttttggactatatgacaag
agatcagtacacaccctgacctcattctgcagcgccttgcacatctccctcatcacacca
agtttccccaccgagggtgaaagccagtttgtactgcagctcagaccaccgttacgaggt
gctctcctgagtttgcttgatcactacgggtggaatcattatgtctttctgtatgacaca
gacaggggatattcaatacttcaagcaattatggaaaaagcaggacaaaatggatggcaa
gttagtgcaatatgcgtagaaaattttaatgatgccagctacagacgcctgttagaagac
ttggatcgaagacaggaaaacaagtttgtaatagactgtgaagttgaaagacttcagaac
attctagaacagattgtcagtgttggaaaacatgtgaaaggctaccactatatcattgca
aacctgggattcaaggatatttcacttgaccggtttatgcatgggggggccaatgtcact
ggattccagctggtagactttaataccccaattgtaactgaactaatgcagcgatggaaa
acactagaccaaagggagtacccaggatcagaatccccaccaaagtatacctctgcactg
acgtacgatggagtactagtaatggccgaagctttccgtattttacgaagacaaaaagtt
gacctctcaagaagaggaaatgcaggggactgtcttgctaacccagctgctccctggggt
cagggaattgacatggagagaacactgaaacaggttcgcattcagggtttaaccggaaat
atacagtttgatcactatggacgaagagtgaactatactatggatgttttagagttgaaa
agtaacggccttagaaagattggttactggaatgatatggataaactggtcttgcttcaa
cacgaaccagcgttcaaaaatgattcttccggtatcgagaacaggactgttattgtcacc
acaatattggaatccccttatgtaatgtacaagaaaaaccatgagctgctggaaggaaat
gataagtttgaaggatattgtgtagatctggcttatgaaattgcaaaacacattggtatc
aagtataaaattgccattgtccctgatggaaaatatggagcaagggattcagaaacaaaa
atctggaatgggatggtgggagagcttgtatacgggaaggcagagattgctgttgcccct
ttgactatcacattggttcgagaagaggtcattgatttctcaaagccctttatgagttta
gggatttctattatgattaagaagcctcagaagtcaaaaccaggagttttctcatttttg
gaccctttggcttatgagatctggatgtgcatagtttttgcttacattggtgtcagtgta
gtcctttttctggtaagcagatttagcccctatgaatggcacacagaggaaccagaggat
ggaaaagaaggacccagtgatcagcctccaaatgaatttggcatatttaatagtctttgg
ttctcccttggagccttcatgcaacaaggatgtgatatatcacctagatctctgtcaggt
cgcattgttggaggagtgtggtggttctttacacttataattatctcatcttatactgca
aatctggctgctttcctaacggttgagagaatggtatctccaatagagagtgcagaagac
cttgccaaacaaacagaaattgcatatggaacactcgatgctgggtcaacaaaagaattc
tttaaaagatctaaaattgctgtgtatgaaaagatgtggacctatatgaaatctgcagag
ccatcggttttcacaaaaacaactgcggaaggggtagctcgtgttcggaaatccaagggc
aagtttgcctttcttctggagtccaccatgaatgagtacatcgagcagagaaagccttgt
gacacaatgaaagttggaggaaatctggattccaaaggatatggagtggcaaccccaaag
cattctcaattaggaaatgctgttaacctggcagttttaaaactgaatgaacaaggcctg
ttggacaaattgaaaaacaaatggtggtacgacaaaggcgaatgtggcggcgggggaggt
gactccaaggacaagacgagtgcattaagcctgagcaacgttgcgggagttttctacatt
ctggttggaggcctgggcttggcaatgctggtggctttgatagagttctgttacaagtca
agggcagaggcgaaacgaatgaagctgaccttttctgaagccataagaaataaagccaga
ttatccataacggggagcataggagaaaatggccgcgtcttgactcccgactgtccgagg
gccgtacacactggaactgcattaagacaaagttcaggattggctgtaattgcatcggac
ctaccataa

DBGET integrated database retrieval system