KEGG   Xenopus laevis (African clawed frog): 100329215Help
Entry
100329215         CDS       T01010                                 

Gene name
p38-beta
Definition
mitogen-activated protein kinase p38 beta
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xla04010]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:xla04370]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xla04068]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:xla04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:xla04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:xla04622]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:xla04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:xla04261]
Human Diseases; Infectious diseases; Salmonella infection [PATH:xla05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 361 aa AA seqDB search
MSGRAGFYKQELNKTVWEVPERYQRLTPVGSGAFGSVCSAFDTKTRQKVAVKKLSRPFQS
LVHARRTYRELRLLKHMKHENVIGLLDVFTPSTSGENFNEVYLVTNLMGADLNNIVKCQK
LTDDHIQFLIYQLLRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQADDEMTG
YVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLKGKALFPGNDYIDQLKRIMEVVGT
PNSEFLMKISSEHARRYIESLPYMPQQDLKEVFHGANPLAIDLLEKMLILDSDKRIAATE
ALAHAYFVQYHDPDDEPEAEPYDESTENKERTIDEWKEITYEEVISFKSLDVKIDNLEIE
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggcgcgctggcttctacaagcaagaactgaacaagacggtgtgggaggtgccg
gagcggtaccagagactcacccctgttggttccggtgccttcggctctgtctgctctgca
ttcgataccaagacacgacaaaaggtggcagtaaaaaagctctccaggccatttcagtca
ctagttcatgcaaggcgaacgtacagggaactgcggctgctcaagcatatgaagcatgag
aatgttattggcttgctggatgttttcacaccatctacttcaggagaaaattttaatgaa
gtgtatctagtgacgaatctaatgggagccgacctcaataacattgtaaagtgccaaaag
ttaacagatgaccatattcaattccttatatatcagttacttagaggcctcaagtatata
cactctgctggcatcatccatagagatttgaagcccagcaatttggcagtaaatgaggac
tgtgaattaaggattctagattttggcttggcacggcaggcagatgatgaaatgactggg
tatgttgcaacaaggtggtacagagctcctgaaatcatgttaaattggatgcattacaat
caaacagttgacatttggtcagtcggatgcatcatggcagagctactgaaaggcaaagct
ctctttcctggaaatgattacattgatcaattaaaaaggataatggaagtggttggaaca
ccgaactcagaatttctcatgaaaatatcatccgaacatgctagaagatacattgaatca
ttaccatatatgccccaacaagatctgaaggaggtgtttcatggtgccaacccattggcg
attgatctgcttgaaaagatgctcattttagacagtgacaagagaatagctgctacagaa
gccctggcacatgcttattttgtacaatatcatgacccagacgatgagcctgaggctgaa
ccttatgacgaatcgacggaaaataaagaacgcaccatagatgaatggaaagagattaca
tatgaagaagtcattagctttaaatcccttgatgttaaaattgataacttggagattgaa
caataa

DBGET integrated database retrieval system