KEGG   Xenopus laevis (African clawed frog): 100337563Help
Entry
100337563         CDS       T01010                                 

Gene name
cdc25c1, cdc25-1-A, cdc25-2, cdc25a
Definition
cell division cycle 25C1 (EC:3.1.3.48)
Orthology
K05867  
M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100337563 (cdc25c1)
   04114 Oocyte meiosis
    100337563 (cdc25c1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100337563 (cdc25c1)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100337563 (cdc25c1)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100337563 (cdc25c1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 599 aa AA seqDB search
MYILLTLLTKSTMESSCDNFEGLEHYYYTDAEPSSKCNKFQASGGSGVVMAESHIMSSEA
PPKSNPGLNIRTNCRMILNLLREKDCSVTFSPEQPLTPVTDLAVGFSNLSTFSGETPKRC
LDLSNLGDETAPLPTESPDRMSSGKLESPKTQFVQFGGLFTPDLAWKAKKCPKRNMNSVL
PHLLCSTPSFKKASGGQRSLSNKENEGELFKNPNCKPVALLLPQEVVDSQLSPTPENKVD
ISLEEDCEMNILGSPISADPPCLDGAHDDIKMQNLDGFADFFSVDEEEMENPPGAVGNLS
CSMAILLSGPLLNQDVEISNVNNISLNRSRLYRSPSMPEKLDRPMLKRPVRPLDSETPVR
VKRRRSTSSPLQPEEENCQPQRRGTSLKKTLSLCDVDISTVLDEDCGHRQLIGDFSKVYA
LPTVTGRHQDLRYITGETLAALMHGDFNSLVEKFFIIDCRYPYEYDGGHIKSAFNLHRQE
EVTDYFLQQPLTPLMVQKRLIIIFHCEFSSERGPKMCRFLREEDRASNDYPSLYYPELYL
LKGGYKDFFPEYKELCEPQSYCPMHHQDFREDLLKFRTKCKTSVGDRKRREQVARLMKL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgtacatattgctgacgcttctaacaaaatccacgatggagagctcctgtgacaacttt
gaaggcctggagcattactactatacagatgctgaaccgtccagcaagtgcaataagttc
caggcaagtggaggttctggtgtagtcatggcagagagtcacataatgtcatcagaagca
cccccaaagtccaacccaggcctgaatatccgtactaactgccgaatgattttgaacctg
ctgcgcgaaaaagattgctctgttacattttcaccggaacagcctttgacacctgtgact
gaccttgctgttggatttagtaacctaagtactttcagtggtgaaactcccaaacgctgc
ctggacttgtccaaccttggtgatgagactgcaccattgccaacagagtctcctgataga
atgtcatcaggtaagctggagtctccaaagacacaatttgtccagtttggtggcctattt
acacctgatctcgcatggaaagcaaagaagtgtccaaagagaaacatgaattctgttctg
ccacaccttctttgcagcactccaagttttaaaaaagcctccggaggacagagaagcttg
tccaataaagaaaatgagggtgagctgtttaagaatccaaactgtaaacctgttgctttg
ctgctaccacaagaagtagttgattcacaattatctccaacacctgagaacaaggtggat
atctccctagaggaggattgtgaaatgaatatcttgggatcccccataagtgctgatccc
ccttgtttggatggagcacatgatgacatcaaaatgcaaaatcttgatggatttgcagat
tttttttctgttgacgaagaggagatggagaatcctcctggagctgttggtaacttgtcc
tgtagtatggcaattcttctgtcggggccccttctaaatcaagatgtagaaatcagcaat
gtaaacaatatatctttaaacagaagccgcctttaccgctcaccttctatgccagagaaa
cttgacaggccaatgcttaaacgcccagtgaggccgctagacagtgaaacacctgtcaga
gtgaaaaggagacgtagtaccagcagcccccttcaacctgaggaagagaactgccaacca
cagaggaggggtacttctcttaaaaagacactttctctttgtgatgtggatatcagtaca
gttttggatgaagattgtggtcacagacaactaattggagatttttcaaaggtttatgct
ttacccactgttactggccgacaccaggacctccgatacatcaccggagagactctggca
gccttaatgcatggagacttcaacagtttagtggagaaattctttataatcgattgccgt
tatccttacgagtatgatggaggacacatcaagagtgcatttaaccttcaccggcaagag
gaggtaacggactactttctgcaacaaccactgaccccgttgatggtacagaagagatta
attataatctttcattgcgagttctcttctgaaagaggcccaaaaatgtgtcggtttctc
agggaggaagacagagccagtaatgattacccaagcctctattacccagagctttatctc
cttaaaggcggttacaaggatttttttcctgaatacaaggagctatgtgaaccgcagagt
tactgcccaatgcaccaccaagatttccgcgaggacctgctgaaattccgaacaaaatgt
aagacttctgttggagatcgaaagaggagggaacaggttgcccgcctgatgaagctttaa

DBGET integrated database retrieval system