KEGG   Xenopus laevis (African clawed frog): 100337576Help
Entry
100337576         CDS       T01010                                 

Gene name
map3k12-b, dlk, map3k12b, mekk12, muk, zpk, zpkp1
Definition
mitogen-activated protein kinase kinase kinase 12 (EC:2.7.11.25)
Orthology
K04423  
mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Module
MAPK (JNK) signaling
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100337576 (map3k12-b)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100337576 (map3k12-b)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   100337576 (map3k12-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 808 aa AA seqDB search
MACLHETRTPSPSFAGLLSDGPIRRLDIDTPPGCTPEQELTPTQCVLRGMVRSEGGSPHN
DDCTTPLTYSVSSDPQKAEDRGGGGAADCPLEDRPCRALGEGRMQCQAGVGFLGGLFGCL
RPVWAMIGKTYSTEHKQGEDPWEVPFEEIQDLQWVGSGAQGAVFLGKFHGEEVAVKKVRD
IKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRKVTPSILVDW
SMSIAGGMNYLHLHKIIHRDLKSPNMLITYDDLVKISDFGTSKELNDKSTKMSFAGTVAW
MAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSLHLPVPSSCP
DGFKLLLRQCWDSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQVEWRDEVRLHFEK
IKSEGTCLQRLEEELITRRREELRHALDIREHYERKLQRANTLYVELNSLMLQLELKEKE
LLRREQTVEKKYPTILRQQPRPSSTMEKLIKKRNVPQKLSPHGKRPDILKYEVLLPKVDS
VLSPSTPTGCQKLPPSPGRGRRGKPRYRKAKDALNFKAAVTPEPTPQSQPPAREPHPLSS
SSPDLLCTPLEAEARRGSQSAECSPVRSLPGPPSPDSPSGRAAGSRAARGGQHLTPSARL
YRAAVTRSQKRGLSSEEEEGEVDSELEVERRQRWPTGMSQNQSPSSENLSDGEEGNTTDL
SHSVTPDVLSTNTDERPDERSEDLVSQSSEPPLDLLTQSDGLSEKEAVIQKVKTQLSNEQ
TAGENVGLYDDSDCDSAELDHSLSATTS
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggcttgtctacatgaaacacgcactccctcaccttcctttgctggtttgctatcagat
ggacccattcgccgcctggatattgatacccctcctggctgtacccctgagcaagaactg
acacccacacaatgtgtccttcgtggtatggtgcgatctgaggggggctctcctcacaat
gatgactgtacaacccccctcacgtacagtgtgtcctcggacccacaaaaggctgaagac
aggggtggagggggtgcagcagattgtcctttagaagacagaccatgtcgggcattgggc
gaaggccgtatgcagtgtcaagcaggggttggctttctcggagggctttttggatgtctg
agacccgtctgggcaatgattggaaaaacctattcaacagaacacaagcagggagaagat
ccatgggaggttccatttgaagaaatccaagacctgcagtgggtgggcagtggagcccaa
ggagccgtcttccttgggaaattccatggtgaagaagtggctgtaaagaaagtgcgagat
attaaagaaacagacatcaaacatctccgcaagctaaaacatcctaacatcatcaccttc
aagggtgtgtgcacacaagctccctgttactgcatccttatggaattctgtgcccagggg
caactgtatgaagtcttgcgtgctgggagaaaggtcaccccctccatattagtagactgg
tccatgagcatcgctggtggaatgaactacttacatctccataaaataatccaccgtgac
ctcaaatcacctaacatgctcatcacctatgatgacttggtgaaaatttctgacttcggt
acctccaaggaattgaatgacaagagcaccaagatgtcctttgcgggtacagttgcttgg
atggcaccagaagtgatacggaatgagcctgtttccgagaaggtggatatttggtccttt
ggtgtggttctatgggagctgttgacaggagagatcccttataaggatgtggattcctcc
gccataatttggggggtgggcagcaacagcctgcacctcccagtaccatccagttgtcca
gacggatttaaactgctgctaaggcagtgctgggacagcaagcctagaaatcgcccctct
tttcggcaaattctgctgcacttagatattgcttcggccgatgtcctgtccaccccccag
gagacctacttcaaatcccaggtggagtggagagatgaggttcggttacattttgagaag
atcaagtcagaaggaacgtgtttgcagcgcttggaagaggagctgataacacggcgccgt
gaggagctaaggcatgccctggatattcgagagcactatgagcgcaagttgcagagagca
aacacgctgtacgtggagctaaattcactcatgctgcagctggagctaaaggagaaggag
ctgctcaggagagagcaaacagtggaaaagaaatatcccacaatactgcgccagcaacct
cgtccctctagtacaatggaaaaacttatcaagaagaggaatgtacctcagaaattatcc
ccacatgggaaaaggccagacattttgaaatatgaagttctgctgccaaaggtagactct
gtcttgtcaccatctacccccactggttgccagaaactccctccatcccctggaaggggc
cgtcggggaaaaccacggtaccgcaaagcaaaggacgcgctcaacttcaaagctgcagtt
actcctgagcccacccctcaaagccagcctcccgctcgtgagccgcatcctctgtcttcc
tcaagccctgatctcttatgtacccctctggaggccgaggcccgtaggggaagtcagagt
gcagagtgttcccctgtccggtctttgcctggacccccaagccctgactccccctcagga
cgggcagcagggagcagagcagccagaggagggcagcacctcaccccatcagccaggctg
tacagagcagctgtcacaaggagtcagaaacgagggctgtcctcggaggaggaagaggga
gaagttgacagtgagttggaggtggagagaagacagaggtggccgacagggatgtcccag
aatcagtcacccagttcggagaatctgtcggacggggaggaagggaacactaccgacctc
tctcacagtgtcacccctgatgtgctgagcactaacacagatgaacgtccggatgagcga
tctgaggatctggtgtcccaaagctcagaacccccactggatcttctcacccagtctgat
ggactctcagagaaagaggcagttatccagaaagtgaaaacacagctgagcaatgagcag
actgcaggagagaatgtcggcctgtacgatgactctgactgtgacagcgctgaacttgac
cactcgctctctgcaacgacctcatga

DBGET integrated database retrieval system