KEGG   Xenopus laevis (African clawed frog): 100337623Help
Entry
100337623         CDS       T01010                                 

Definition
cytochrome P450 (EC:1.14.14.1)
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100337623
  Amino acid metabolism
   00380 Tryptophan metabolism
    100337623
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100337623
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100337623
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100337623
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP1 family
   100337623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 526 aa AA seqDB search
MTDWIGSIAGLMANTTITEFLLVSTVFAIVFLVLRSERVKIPPGTKKLPGPMPYPIIGNL
LSLSKNPHLSLTRMSKTYGDVFQIQIGTKPVLVLSGLETLKQALIRQGDEFAGRPDLFTF
RLVGDGKSLTFSSDSGEVWRARRRLAHNALKTFATSPSPTSSSSCLVEENIITEAEYLVR
KFKQLIDEKGEFDPYRYVVVSVANVICGMCFGKRYNHDDEELLNVVNLTDEFGAAAASGN
PADFIPILQYLPSSSMKAFKEINRKFLDFIQKLVKEHYKTFDKNHIRDITDSLIQHSQEK
RVDENSNVQLSNQKIVNIVNDLFGAGFDTITTALSWSLMYLVAHPNIQEKIQDELDQVIG
RERRPRLSDRAQLPYTEAFILEMFRHSSFVPFTIPHSSTTDTVLNGYFIPKGICVLINQW
QVNHDPNLWKDPFKFCPERFLNTDGTTLNKIEMEKVMIFGLGKRRCVGEVIGRMEVFLFL
TTMLQQMQFFKQDGEKLDMSPQYGLTMKHKRCHVTAKIRFPLLATH
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacagattggataggttcaattgctgggttgatggcgaataccaccatcactgagttt
cttctggtatctacagtctttgccattgtgtttctggtgcttaggtcagaaagagtcaaa
atcccaccaggaacaaagaaactaccagggcctatgccttatcctattattgggaatttg
ttatcattgagcaagaatccacaccttagcctgacaagaatgagcaaaacttatggtgat
gtgttccagattcagataggcacaaagcctgtgctggtccttagtgggctggagaccctc
aagcaagctcttatacggcaaggtgatgagtttgctggacgcccagacctctttactttc
cgcttggttggtgatgggaagagcctgaccttcagcagtgattctggagaggtgtggaga
gctcgacgcagacttgcacacaatgccctcaaaacatttgccacttccccttcacccaca
tcatcaagttcttgccttgttgaagaaaacattattacagaagcagaatatttagtaaga
aagttcaagcaattaattgatgagaaaggagagtttgacccctacaggtatgtggtggtc
tctgttgccaatgtcatctgtggcatgtgctttggtaaacgatataatcatgatgacgaa
gagcttctgaatgtggtgaatcttactgatgagtttggtgcagcagctgcttcaggcaac
cctgcagatttcatcccgattctacaatatcttccgagctcaagcatgaaggccttcaag
gaaatcaacagaaagttcctagacttcatacagaaattagtcaaagagcactacaaaaca
tttgacaagaaccatatacgagatattactgattcacttatccaacactcccaggaaaag
agagttgatgaaaactcaaatgttcagttatcaaatcaaaaaattgtgaatatagtaaat
gacctctttggtgctgggtttgataccattaccactgctctctcctggagtctcatgtac
cttgtggcccatcctaacatacaagaaaaaattcaggacgaactggaccaagttattgga
agagaaagacgaccccgattatcagacagagctcaactgccctatactgaagcttttata
ttggagatgttccgacattcttctttcgtgccattcacaattccacatagttcaaccaca
gacacagtgttaaatggatatttcatccccaagggaatttgtgtgctgatcaaccagtgg
caagtgaatcacgatccgaacctgtggaaagatccattcaaattctgtccagagcgtttc
ttaaacactgatggcacaacgttgaacaaaatcgagatggagaaagtaatgatttttggc
ttaggaaaaagaaggtgtgtcggtgaagtcattgggaggatggaggtcttccttttcctc
actaccatgctccagcagatgcagttcttcaaacaggatggagaaaaactggacatgtcc
ccgcagtatggactaacaatgaaacacaagcgttgtcatgtcacagctaaaattcgtttt
cctttgttagccacacattaa

DBGET integrated database retrieval system