KEGG   Xenopus laevis (African clawed frog): 100337623Help
Entry
100337623         CDS       T01010                                 

Definition
cytochrome P450 (EC:1.14.14.1)
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:xla00140]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:xla00380]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:xla00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:xla00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 526 aa AA seqDB search
MTDWIGSIAGLMANTTITEFLLVSTVFAIVFLVLRSERVKIPPGTKKLPGPMPYPIIGNL
LSLSKNPHLSLTRMSKTYGDVFQIQIGTKPVLVLSGLETLKQALIRQGDEFAGRPDLFTF
RLVGDGKSLTFSSDSGEVWRARRRLAHNALKTFATSPSPTSSSSCLVEENIITEAEYLVR
KFKQLIDEKGEFDPYRYVVVSVANVICGMCFGKRYNHDDEELLNVVNLTDEFGAAAASGN
PADFIPILQYLPSSSMKAFKEINRKFLDFIQKLVKEHYKTFDKNHIRDITDSLIQHSQEK
RVDENSNVQLSNQKIVNIVNDLFGAGFDTITTALSWSLMYLVAHPNIQEKIQDELDQVIG
RERRPRLSDRAQLPYTEAFILEMFRHSSFVPFTIPHSSTTDTVLNGYFIPKGICVLINQW
QVNHDPNLWKDPFKFCPERFLNTDGTTLNKIEMEKVMIFGLGKRRCVGEVIGRMEVFLFL
TTMLQQMQFFKQDGEKLDMSPQYGLTMKHKRCHVTAKIRFPLLATH
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacagattggataggttcaattgctgggttgatggcgaataccaccatcactgagttt
cttctggtatctacagtctttgccattgtgtttctggtgcttaggtcagaaagagtcaaa
atcccaccaggaacaaagaaactaccagggcctatgccttatcctattattgggaatttg
ttatcattgagcaagaatccacaccttagcctgacaagaatgagcaaaacttatggtgat
gtgttccagattcagataggcacaaagcctgtgctggtccttagtgggctggagaccctc
aagcaagctcttatacggcaaggtgatgagtttgctggacgcccagacctctttactttc
cgcttggttggtgatgggaagagcctgaccttcagcagtgattctggagaggtgtggaga
gctcgacgcagacttgcacacaatgccctcaaaacatttgccacttccccttcacccaca
tcatcaagttcttgccttgttgaagaaaacattattacagaagcagaatatttagtaaga
aagttcaagcaattaattgatgagaaaggagagtttgacccctacaggtatgtggtggtc
tctgttgccaatgtcatctgtggcatgtgctttggtaaacgatataatcatgatgacgaa
gagcttctgaatgtggtgaatcttactgatgagtttggtgcagcagctgcttcaggcaac
cctgcagatttcatcccgattctacaatatcttccgagctcaagcatgaaggccttcaag
gaaatcaacagaaagttcctagacttcatacagaaattagtcaaagagcactacaaaaca
tttgacaagaaccatatacgagatattactgattcacttatccaacactcccaggaaaag
agagttgatgaaaactcaaatgttcagttatcaaatcaaaaaattgtgaatatagtaaat
gacctctttggtgctgggtttgataccattaccactgctctctcctggagtctcatgtac
cttgtggcccatcctaacatacaagaaaaaattcaggacgaactggaccaagttattgga
agagaaagacgaccccgattatcagacagagctcaactgccctatactgaagcttttata
ttggagatgttccgacattcttctttcgtgccattcacaattccacatagttcaaccaca
gacacagtgttaaatggatatttcatccccaagggaatttgtgtgctgatcaaccagtgg
caagtgaatcacgatccgaacctgtggaaagatccattcaaattctgtccagagcgtttc
ttaaacactgatggcacaacgttgaacaaaatcgagatggagaaagtaatgatttttggc
ttaggaaaaagaaggtgtgtcggtgaagtcattgggaggatggaggtcttccttttcctc
actaccatgctccagcagatgcagttcttcaaacaggatggagaaaaactggacatgtcc
ccgcagtatggactaacaatgaaacacaagcgttgtcatgtcacagctaaaattcgtttt
cctttgttagccacacattaa

DBGET integrated database retrieval system