KEGG   Xenopus laevis (African clawed frog): 100337623Help
Entry
100337623         CDS       T01010                                 

Gene name
cyp1a1.S, ahh, ahrr, cp11, cyp1, cyp1a, p1-450, p450-c, p450dx
Definition
(RefSeq) cytochrome P450 family 1 subfamily A member 1 S homeolog
  KO
K07408  cytochrome P450 family 1 subfamily A polypeptide 1 [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla00140  Steroid hormone biosynthesis
xla00380  Tryptophan metabolism
xla00830  Retinol metabolism
xla00980  Metabolism of xenobiotics by cytochrome P450
xla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100337623 (cyp1a1.S)
  Amino acid metabolism
   00380 Tryptophan metabolism
    100337623 (cyp1a1.S)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100337623 (cyp1a1.S)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100337623 (cyp1a1.S)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100337623 (cyp1a1.S)
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP1 family
   100337623 (cyp1a1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 eIF3_subunit Sec8_exocyst
Motif
Other DBs
NCBI-GeneID: 100337623
NCBI-ProteinID: NP_001165708
Xenbase: XB-GENE-17337069
UniProt: Q9YI89
Position
3S
AA seq 526 aa AA seqDB search
MTDWIGSIAGLMANTTITEFLLVSTVFAIVFLVLRSERVKIPPGTKKLPGPMPYPIIGNL
LSLSKNPHLSLTRMSKTYGDVFQIQIGTKPVLVLSGLETLKQALIRQGDEFAGRPDLFTF
RLVGDGKSLTFSSDSGEVWRARRRLAHNALKTFATSPSPTSSSSCLVEENIITEAEYLVR
KFKQLIDEKGEFDPYRYVVVSVANVICGMCFGKRYNHDDEELLNVVNLTDEFGAAAASGN
PADFIPILQYLPSSSMKAFKEINRKFLDFIQKLVKEHYKTFDKNHIRDITDSLIQHSQEK
RVDENSNVQLSNQKIVNIVNDLFGAGFDTITTALSWSLMYLVAHPNIQEKIQDELDQVIG
RERRPRLSDRAQLPYTEAFILEMFRHSSFVPFTIPHSSTTDTVLNGYFIPKGICVLINQW
QVNHDPNLWKDPFKFCPERFLNTDGTTLNKIEMEKVMIFGLGKRRCVGEVIGRMEVFLFL
TTMLQQMQFFKQDGEKLDMSPQYGLTMKHKRCHVTAKIRFPLLATH
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacagattggataggttcaattgctgggttgatggcgaataccaccatcactgagttt
cttctggtatctacagtctttgccattgtgtttctggtgcttaggtcagaaagagtcaaa
atcccaccaggaacaaagaaactaccagggcctatgccttatcctattattgggaatttg
ttatcattgagcaagaatccacaccttagcctgacaagaatgagcaaaacttatggtgat
gtgttccagattcagataggcacaaagcctgtgctggtccttagtgggctggagaccctc
aagcaagctcttatacggcaaggtgatgagtttgctggacgcccagacctctttactttc
cgcttggttggtgatgggaagagcctgaccttcagcagtgattctggagaggtgtggaga
gctcgacgcagacttgcacacaatgccctcaaaacatttgccacttccccttcacccaca
tcatcaagttcttgccttgttgaagaaaacattattacagaagcagaatatttagtaaga
aagttcaagcaattaattgatgagaaaggagagtttgacccctacaggtatgtggtggtc
tctgttgccaatgtcatctgtggcatgtgctttggtaaacgatataatcatgatgacgaa
gagcttctgaatgtggtgaatcttactgatgagtttggtgcagcagctgcttcaggcaac
cctgcagatttcatcccgattctacaatatcttccgagctcaagcatgaaggccttcaag
gaaatcaacagaaagttcctagacttcatacagaaattagtcaaagagcactacaaaaca
tttgacaagaaccatatacgagatattactgattcacttatccaacactcccaggaaaag
agagttgatgaaaactcaaatgttcagttatcaaatcaaaaaattgtgaatatagtaaat
gacctctttggtgctgggtttgataccattaccactgctctctcctggagtctcatgtac
cttgtggcccatcctaacatacaagaaaaaattcaggacgaactggaccaagttattgga
agagaaagacgaccccgattatcagacagagctcaactgccctatactgaagcttttata
ttggagatgttccgacattcttctttcgtgccattcacaattccacatagttcaaccaca
gacacagtgttaaatggatatttcatccccaagggaatttgtgtgctgatcaaccagtgg
caagtgaatcacgatccgaacctgtggaaagatccattcaaattctgtccagagcgtttc
ttaaacactgatggcacaacgttgaacaaaatcgagatggagaaagtaatgatttttggc
ttaggaaaaagaaggtgtgtcggtgaagtcattgggaggatggaggtcttccttttcctc
actaccatgctccagcagatgcagttcttcaaacaggatggagaaaaactggacatgtcc
ccgcagtatggactaacaatgaaacacaagcgttgtcatgtcacagctaaaattcgtttt
cctttgttagccacacattaa

DBGET integrated database retrieval system