KEGG   Xenopus laevis (African clawed frog): 100380988Help
Entry
100380988         CDS       T01010                                 

Gene name
abhd12.S, abhd12
Definition
(RefSeq) abhydrolase domain containing 12 S homeolog
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100380988 (abhd12.S)
Peptidases [BR:xla01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100380988 (abhd12.S)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100380988 (abhd12.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
Position
5S
AA seq 386 aa AA seqDB search
MRKRAEPGAPENENFVRAPLDRECSLKQKLRIAGAKGHYPHDSDCDSKEMKRFGRRYGLW
SRLRMFLIFLVGLYIAIPFLVKVCPAIQTQLVFLNLVRFPYFIDLKRPQDQGLNHTCNFY
LQPEEDVSIGVWHTIPAVLWKEAQGKDLEWYEEVLSTNYPVILYLHGNAGTRGGDHRVQL
YKVLSSMGYHVISFDYRGWGDSAGSPSESGMTYDALHAFDWIKARSGDNPVYIWGHSLGT
GVATNLVRRLCERETPPDALMLESPFTNIREEAKSHPFSVIYRYFPGFDWFFLDTITASG
IKFANDDNVKYISCPLLILHAEDDPVIPFHLGKKLYNIAAPARSLRDYKVQFVPFHKDLG
YRHKYIYRSPELHQILRDFLGNNEQQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagagagccgagccgggggccccggaaaatgagaactttgtcagggccccgctg
gacagggagtgcagtctaaagcagaagctgagaatcgctggcgcaaagggccattatcca
cacgactccgactgcgacagcaaggaaatgaagaggttcggcaggcgttatggtttgtgg
tcccggctccgaatgtttctaatctttctagtcggactgtatatagcaattccattcctt
gtaaaggtctgccctgctattcaaactcagctggtgtttttaaatttagtaaggtttcca
tattttattgacttgaagaggcctcaggatcaaggcttaaaccacacatgcaatttttac
ttacagccagaggaggatgtgtccattggagtttggcataccattcctgcagttttatgg
aaagaagctcaaggaaaagacctagagtggtacgaggaggttttatctacaaattaccct
gtgatcctctatctgcatggaaatgccggcacacgaggaggtgatcacagagtgcagctt
tataaggtgctcagttccatgggataccacgtaatttcctttgactacagaggatggggc
gattctgcaggttctccgtcagagagcggaatgacctatgatgctctgcacgcttttgat
tggataaaggcacggagcggagacaatccagtttacatatgggggcactcattaggcaca
ggggttgcaaccaatctagtaagaagactttgtgaaagagaaactcctcctgatgccctg
atgcttgaatctccatttaccaatattcgggaggaggccaagagccatccattttctgtg
atatatagatatttcccaggctttgactggtttttcttagacaccatcacagcaagtggc
attaagtttgctaacgatgataatgtgaaatatatttcctgtcccctgctcatattacac
gcagaagacgaccctgttattccattccatcttggaaaaaagctttacaacatcgcagct
ccggcacgaagtctacgtgactacaaagttcagtttgttccattccacaaagatctggga
tacaggcacaagtacatataccgaagcccagagttgcaccagatactgagggatttcctg
ggaaacaatgagcaacaataa

DBGET integrated database retrieval system