KEGG   Xenopus laevis (African clawed frog): 100505423Help
Entry
100505423         CDS       T01010                                 

Definition
(RefSeq) uncharacterized LOC100505423
  KO
K07827  
GTPase Kras
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Mitophagy - animal
Autophagy - animal
mTOR signaling pathway
Apoptosis
Dorso-ventral axis formation
VEGF signaling pathway
Apelin signaling pathway
Gap junction
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100505423
   04012 ErbB signaling pathway
    100505423
   04370 VEGF signaling pathway
    100505423
   04371 Apelin signaling pathway
    100505423
   04068 FoxO signaling pathway
    100505423
   04150 mTOR signaling pathway
    100505423
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100505423
   04137 Mitophagy - animal
    100505423
  Cell growth and death
   04210 Apoptosis
    100505423
  Cellular community - eukaryotes
   04540 Gap junction
    100505423
  Cell motility
   04810 Regulation of actin cytoskeleton
    100505423
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100505423
   04912 GnRH signaling pathway
    100505423
   04914 Progesterone-mediated oocyte maturation
    100505423
   04916 Melanogenesis
    100505423
  Development
   04320 Dorso-ventral axis formation
    100505423
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100505423
Membrane trafficking [BR:xla04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100505423
GTP-binding proteins [BR:xla04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    100505423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 187 aa AA seqDB search
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNIKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKS
KTKCIIL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgacggagtacaagctggtggtggttggtgctggaggtgtagggaagagcgccctgacc
attcagctcattcagaatcattttgtggatgaatatgatcccaccatagaggactcgtat
aggaaacaagtggtgatcgatggggagacgtgtctgttggacatactggacactgcgggg
caggaggaatacagtgcaatgcgggaccagtatatgaggaccggcgagggcttcctctgt
gtctttgccattaataacatcaagtcctttgaggatattcaccattatagagagcagatc
aagcgagtgaaggattcggaggacgtgccgatggttctggtggggaacaagtgcgactta
ccctcccggacggtggacaccaaacaagcccaggacttggccaggagttacgggattcct
tttatcgagacctcggccaaaaccagacagggcgtggacgacgctttctacacgttggtc
cgagaaatccggaagcacaaagagaagatgagcaaagacggcaaaaagaagaagaaatct
aaaacaaagtgtataattttgtga

DBGET integrated database retrieval system