KEGG   Xenopus laevis (African clawed frog): 100505436Help
Entry
100505436         CDS       T01010                                 

Definition
uncharacterized LOC100505436
Orthology
K11275  
histone H1/5
Organism
xla  Xenopus laevis (African clawed frog)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 194 aa AA seqDB search
MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKV
GENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKGDEPKRSVAFKKTKKEVKKVATP
KKAAKPKKAASKAPSKKPKATPVKKAKKKPAATPKKAKKPKVVKVKPVKASKPKKAKTVK
PKAKSSAKRGSKKK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaactccacctccgccccggcggcgaagcccaaacgggccaaggcttccaag
aagtccacggaccaccccaagtattcagacatgatcgtggctgctatccaggcagagaag
aaccgtgccggctcctcgcgccagtccatccaaaagtatatcaagagccactacaaggtg
ggtgagaacgccgactcccagatcaagttgtccatcaagcgcctagtgaccaccggtgtt
ctcaagcaaaccaaaggggtgggcgcctcggggtccttcaggctggccaagggcgatgag
cccaaaaggtcggtggctttcaagaagaccaagaaggaagtcaagaaagtggccactcca
aagaaggcagccaagcccaagaaggctgcctccaaagccccaagcaagaaacccaaagcc
acccctgtcaagaaggccaagaagaagccggctgccacgcccaagaaagccaaaaagccc
aaggttgtcaaagtcaaaccagtcaaggcctccaaacccaagaaggccaaaaccgtgaag
cccaaagccaagtcgagtgccaagaggggcagcaagaagaagtga

DBGET integrated database retrieval system