KEGG   Xenopus laevis (African clawed frog): 373549Help
Entry
373549            CDS       T01010                                 

Gene name
cypxl301-a
Definition
cytochrome P450 XL-301
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 515 aa AA seqDB search
MASNLWEVLSSPGLFGNIYQFGQFAAQLCLVLLLLKAWGLFIRWKSLKDALQNFPGPPKH
WLYGHANQFRGDGTDMDRVLAWADKYPKAFPMWVGQFFANLIITNPEYAKAVFARSDPKT
PTGYNFLIPWIGKGLLVLSGDKWFQHRKLLTPGFHYDVLKPYVRLISDSTNVMLDKWVSF
SNKGETVELFHHVSLMTLDSIMKCAFSYHSNCQTDKDNSYTKAVYDLSFLAHHRARTFPY
HNNLIYYLSPHGFLFRKACRIAHQHTGKVIKQRKTLLQNKGEFEKVKQKRHPDFLDILLC
ARDENGKGLSDEDLRAEVDTFMFEGHDTTASGISWILYCMAKYPEHQQKCREEIREVLGE
KDSFEWEHLSKIPYTTMCIKESLRLYPPVPGVSRELNKPITFYDGRSLPAGSVIFINIFC
IHRNPSVWKDPEVFDPLRFSSENSSKRHSHAFVPFAAGPRNCIGQNFAMNELKVAVALTL
NRYELSPHLSKPPLKSPQLVLRSKNGIHVYLKKAS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaatctgtgggaagtgctgagttcccccgggctgtttgggaacatttaccag
tttggtcagtttgctgcacagctgtgcctggttctgctgctgctgaaagcctggggttta
tttatcaggtggaaaagtctcaaggatgcattgcagaattttcctggtccccccaaacac
tggttatatgggcacgccaatcagttccgaggagatgggacagatatggacagggttctc
gcatgggcagataaatatcctaaagcatttccaatgtgggttggacaattcttcgccaac
ctcatcattactaacccggagtatgcaaaagctgtgtttgccagatcagatcctaaaaca
ccaactgggtacaattttcttatcccatggattggaaaaggcttgcttgtcctctcagga
gataagtggttccagcaccgcaagcttctcactccaggatttcactatgacgttctgaaa
ccttatgtcagactgatttcagattctacaaatgtcatgctggataaatgggtttcattt
tccaataaaggtgaaacagtggagcttttccaccatgtcagcctgatgacactggacagc
atcatgaaatgtgccttcagctaccatagcaactgccagactgataaagataattcctac
acgaaggctgtttatgatctctccttcctggctcatcacagggcacgtacttttccttat
cacaataatctgatttactatctcagtccccatggattccttttccgtaaagcctgcaga
atagctcaccagcacacaggtaaggttattaaacagagaaaaacattgctacagaataag
ggggagtttgagaaggtcaagcagaagcgccacccagatttcttggacatccttctttgt
gccagggatgaaaatgggaagggtttatctgatgaggacctccgtgcagaggtggacaca
tttatgtttgaaggccatgacacaacagccagtggcatctcctggattttatactgcatg
gccaaatacccagagcaccagcagaaatgccgggaggagatcagggaagtacttggtgag
aaggattcttttgaatgggagcatcttagcaaaatcccctacaccacaatgtgcatcaag
gagagtctccgcctttatcctccagtcccaggtgtatctagggaactaaacaaaccaatt
acattttatgatggacggtccttacctgctggctccgtaattttcataaatattttctgc
attcatcggaatcccagtgtttggaaagatccagaggtgtttgatccactccggttttcc
tcagaaaactcttcaaagcgtcactcccatgcttttgttccttttgctgctggaccaaga
aactgcattggacagaactttgctatgaatgaactgaaagtggctgtggctctaacgtta
aaccgttatgaattatccccgcatctatcaaaaccgcccctgaaatcaccacaacttgtt
ctgcgctccaaaaatggcatccacgtgtacctaaagaaagcaagctaa

DBGET integrated database retrieval system