KEGG   Xenopus laevis (African clawed frog): 373633Help
Entry
373633            CDS       T01010                                 

Gene name
pgr-a, XPR-1, pgr, xpr-2
Definition
progesterone receptor
Orthology
K08556  
progesterone receptor
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Oocyte meiosis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    373633 (pgr-a)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    373633 (pgr-a)
Transcription factors [BR:xla03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    373633 (pgr-a)
Nuclear receptors [BR:xla03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   373633 (pgr-a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 732 aa AA seqDB search
MEEISQTPGDDPARTGTQVLPEDSSLDSLLYQRPEHEGSYLKGEGPSSPDNNDLENVLDS
ILDSSSASSHLHSWTHFAAPEVSRVTPHMCPSDEAKALSIHHTSSLEETSLWAAPTLVER
KEPGDSMPLKGKNSLEETKEPNSSLTMDSDETVTSILPILPPDLNLNNMPILPLNPAYLA
VRARQILGGEEGGQRSSPDTFQTSIPYANLQPNMKQISYFYPDTQPDFRIKKESSTVSLY
KAAAKESTLGQDYGSSPQNPSTPDPDPSLNFILYKNDSACDYDSFKISYGNTSEGSGCVL
PSTSAQTIYQPLSLNGHQHITFQPTSMKETYLSEIQLPYVSYIRSDGNPDPGSPFSFETF
PQKICLICGDEASGCHYGVLTCGSCKVFFKRAIEGQHNYLCAGRNDCIVDKIRRKNCPSC
RLRKCCQAGMVLGGRKFKKFGRIKTGREIDTVVLQSPPTLSLECQQILIRRISNSSAQEI
QFTPELLQILQSIEPEVVYAGYDNTQPETPSALLSSLNQLCERQLVCVVKWSKSLPGFRN
LHIDDQITLLQYSWMSLMVFALGWRSYQHVSGQMLYFAPDLILNEQRMKDSSFYTLCLSM
WQLPQEFMKLQVTHEEFLCMKALLLLNTIPLEGLKSQTNFDEMRSNYIRELAKAIGLRHK
GVIASSQRFYQLTKLMDSMHELVKQLHLYCLNTFLQSRSLSVEFPEMMSEVISAQLPKIL
AGMVKPLVFHKK
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggaggagataagtcagacacctggagatgatcctgcaagaactgggacccaggtactt
cccgaggactcctcattggacagtcttttgtaccagagacccgaacatgagggctcctat
ctgaaaggggaagggccttcatctcctgataacaatgacttggagaacgtgctggactct
atcctggattcctcctcagcctcctctcacctccactcctggactcattttgctgcccct
gaggtatctcgggtaactcctcacatgtgtccctctgatgaagctaaagctctcagtatc
caccatacttcttccctggaggaaaccagtctttgggctgcacctacactagttgaaagg
aaagaacctggagactctatgcccctgaaagggaaaaactctttggaagagaccaaagaa
cccaactcatcattgaccatggatagtgatgaaactgttacatcgatcctgcccatattg
ccaccagatctgaacctgaacaatatgcccatcctgccactgaacccagcatacctagca
gtcagggctcgccagattctgggcggggaagaaggtggccaaaggtcttctcctgacact
ttccagacttcgattccatatgcaaatcttcagcccaacatgaaacaaatttcttatttt
tatcctgatacacagccagatttcagaattaaaaaggaaagctctacagtctctctgtat
aaagcagcagccaaagaaagcacattgggtcaggattacggatcgtctccccagaatcct
tcaactcccgatccagatccttccttgaatttcattctgtacaaaaatgattctgcctgt
gattatgacagttttaagatttcttatgggaacacaagtgagggctcaggctgtgttctg
ccctcaacctcagcccagaccatctaccagcccttgagcctcaatggtcatcagcatatt
actttccaaccaacatcaatgaaagagacatatttatccgaaatccagctcccctatgtg
tcttatatcaggagcgatgggaacccagacccaggcagtcccttcagctttgagacgttt
ccgcagaagatctgcttgatctgcggtgatgaagcttcagggtgtcactatggagtcctg
acttgtggcagctgcaaggtcttctttaaaagagccatagaagggcagcacaactatctg
tgtgcgggtaggaatgactgcatcgtggataagatcaggaggaagaactgtccttcctgc
cgactgagaaagtgttgccaagcaggaatggtacttggaggtcgaaaatttaaaaagttc
ggtcgaattaaaactgggagagaaatcgatacagttgttcttcagtcgccaccaactctg
tcgctggaatgtcagcagattctaataaggagaatatccaacagttccgctcaggaaatc
cagttcaccccagagttgctccagatcttgcagagtatagagcctgaggttgtatatgct
ggttacgataacacacagcccgagaccccaagtgcattgttgagtagtctcaatcagctt
tgtgaacggcaactcgtttgtgtagtaaaatggtccaagtcccttcccgggtttagaaac
ttacacatcgatgaccagattacccttttgcaatattcttggatgagcctgatggtgttt
gccctgggatggaggtcgtatcaacatgtcagtgggcaaatgctgtattttgctccagat
ttgatattaaatgaacaaagaatgaaagattcgtcattctataccctgtgcctctccatg
tggcagctgccgcaagagtttatgaaattacaagttacccacgaggagttcctgtgcatg
aaggctttgctgctgctcaacacaattcctttggaaggacttaaaagtcagactaatttt
gatgagatgaggtcaaactacataagagagctggccaaggctattggcttaagacataaa
ggtgtgattgccagctcccagcgtttctatcaactaaccaaactcatggactccatgcat
gaacttgtaaagcagcttcacctttattgtctcaacacattcctgcagtcaagatcgctt
agcgtggaatttcctgaaatgatgtcggaagtgatctctgcccagttacccaagatccta
gctgggatggtaaaaccacttgtgtttcacaaaaagtga

DBGET integrated database retrieval system