KEGG   Xenopus laevis (African clawed frog): 373633Help
Entry
373633            CDS       T01010                                 

Gene name
pgr-a, XPR-1, pgr, xpr-2
Definition
progesterone receptor
Orthology
K08556  
progesterone receptor
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Oocyte meiosis
Progesterone-mediated oocyte maturation
Class
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xla04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 732 aa AA seqDB search
MEEISQTPGDDPARTGTQVLPEDSSLDSLLYQRPEHEGSYLKGEGPSSPDNNDLENVLDS
ILDSSSASSHLHSWTHFAAPEVSRVTPHMCPSDEAKALSIHHTSSLEETSLWAAPTLVER
KEPGDSMPLKGKNSLEETKEPNSSLTMDSDETVTSILPILPPDLNLNNMPILPLNPAYLA
VRARQILGGEEGGQRSSPDTFQTSIPYANLQPNMKQISYFYPDTQPDFRIKKESSTVSLY
KAAAKESTLGQDYGSSPQNPSTPDPDPSLNFILYKNDSACDYDSFKISYGNTSEGSGCVL
PSTSAQTIYQPLSLNGHQHITFQPTSMKETYLSEIQLPYVSYIRSDGNPDPGSPFSFETF
PQKICLICGDEASGCHYGVLTCGSCKVFFKRAIEGQHNYLCAGRNDCIVDKIRRKNCPSC
RLRKCCQAGMVLGGRKFKKFGRIKTGREIDTVVLQSPPTLSLECQQILIRRISNSSAQEI
QFTPELLQILQSIEPEVVYAGYDNTQPETPSALLSSLNQLCERQLVCVVKWSKSLPGFRN
LHIDDQITLLQYSWMSLMVFALGWRSYQHVSGQMLYFAPDLILNEQRMKDSSFYTLCLSM
WQLPQEFMKLQVTHEEFLCMKALLLLNTIPLEGLKSQTNFDEMRSNYIRELAKAIGLRHK
GVIASSQRFYQLTKLMDSMHELVKQLHLYCLNTFLQSRSLSVEFPEMMSEVISAQLPKIL
AGMVKPLVFHKK
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggaggagataagtcagacacctggagatgatcctgcaagaactgggacccaggtactt
cccgaggactcctcattggacagtcttttgtaccagagacccgaacatgagggctcctat
ctgaaaggggaagggccttcatctcctgataacaatgacttggagaacgtgctggactct
atcctggattcctcctcagcctcctctcacctccactcctggactcattttgctgcccct
gaggtatctcgggtaactcctcacatgtgtccctctgatgaagctaaagctctcagtatc
caccatacttcttccctggaggaaaccagtctttgggctgcacctacactagttgaaagg
aaagaacctggagactctatgcccctgaaagggaaaaactctttggaagagaccaaagaa
cccaactcatcattgaccatggatagtgatgaaactgttacatcgatcctgcccatattg
ccaccagatctgaacctgaacaatatgcccatcctgccactgaacccagcatacctagca
gtcagggctcgccagattctgggcggggaagaaggtggccaaaggtcttctcctgacact
ttccagacttcgattccatatgcaaatcttcagcccaacatgaaacaaatttcttatttt
tatcctgatacacagccagatttcagaattaaaaaggaaagctctacagtctctctgtat
aaagcagcagccaaagaaagcacattgggtcaggattacggatcgtctccccagaatcct
tcaactcccgatccagatccttccttgaatttcattctgtacaaaaatgattctgcctgt
gattatgacagttttaagatttcttatgggaacacaagtgagggctcaggctgtgttctg
ccctcaacctcagcccagaccatctaccagcccttgagcctcaatggtcatcagcatatt
actttccaaccaacatcaatgaaagagacatatttatccgaaatccagctcccctatgtg
tcttatatcaggagcgatgggaacccagacccaggcagtcccttcagctttgagacgttt
ccgcagaagatctgcttgatctgcggtgatgaagcttcagggtgtcactatggagtcctg
acttgtggcagctgcaaggtcttctttaaaagagccatagaagggcagcacaactatctg
tgtgcgggtaggaatgactgcatcgtggataagatcaggaggaagaactgtccttcctgc
cgactgagaaagtgttgccaagcaggaatggtacttggaggtcgaaaatttaaaaagttc
ggtcgaattaaaactgggagagaaatcgatacagttgttcttcagtcgccaccaactctg
tcgctggaatgtcagcagattctaataaggagaatatccaacagttccgctcaggaaatc
cagttcaccccagagttgctccagatcttgcagagtatagagcctgaggttgtatatgct
ggttacgataacacacagcccgagaccccaagtgcattgttgagtagtctcaatcagctt
tgtgaacggcaactcgtttgtgtagtaaaatggtccaagtcccttcccgggtttagaaac
ttacacatcgatgaccagattacccttttgcaatattcttggatgagcctgatggtgttt
gccctgggatggaggtcgtatcaacatgtcagtgggcaaatgctgtattttgctccagat
ttgatattaaatgaacaaagaatgaaagattcgtcattctataccctgtgcctctccatg
tggcagctgccgcaagagtttatgaaattacaagttacccacgaggagttcctgtgcatg
aaggctttgctgctgctcaacacaattcctttggaaggacttaaaagtcagactaatttt
gatgagatgaggtcaaactacataagagagctggccaaggctattggcttaagacataaa
ggtgtgattgccagctcccagcgtttctatcaactaaccaaactcatggactccatgcat
gaacttgtaaagcagcttcacctttattgtctcaacacattcctgcagtcaagatcgctt
agcgtggaatttcctgaaatgatgtcggaagtgatctctgcccagttacccaagatccta
gctgggatggtaaaaccacttgtgtttcacaaaaagtga

DBGET integrated database retrieval system