KEGG   Xenopus laevis (African clawed frog): 373656Help
Entry
373656            CDS       T01010                                 

Gene name
cyp19a1, P450_arom, aro, cyp19, cyp19a, p450arom-A
Definition
cytochrome P450, family 19, subfamily A, polypeptide 1 (EC:1.14.14.1)
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    373656 (cyp19a1)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     373656 (cyp19a1)
Cytochrome P450 [BR:xla00199]
 Cytochrome P450, animal type
  CYP19 family
   373656 (cyp19a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 500 aa AA seqDB search
MEALNPVQYNITEAVPTLAPATTLSLLLFIFVLIILWNQEETSLIPGPAYCMGLGPLISY
GRFLLTGIGKAANYYNNMYGEFVRVWINGEETLIISKSSATFHIMKHSHYVSRFGSKLGL
QCIGMNENGIIFNSNPSLWKVIRPYFIRALSGPGLMQTTENCIRSTNHYLDNLSNVTNEL
GNVDVLKLMRLIMLDTSNNLFLRIPLDENEIVLKIQKYFDAWQALLLKPDIFFKISWLYK
KYEKSANDLKEAIELLIEQKRQKLSSSEKLDEDMDFSSELIFAQNHGDLTAENVNQCILE
MLIAAPDTMSVSLFFMLVLIAQHPKIEEGIMNEMDKVIGDRDVESNDIPNLKILESFIYE
SMRYQPVVDLVMRKALEDDIIDGYYVKKGTNIILNLGRMHKIEYFPKPNEFTLENFEKTV
PYRYFQPFGSGPRACAGKYIAMVMMKVILVTLLKRYKVQTLRGRCLENIQNNNDLSMHPD
ESQPSLEMIFIPKNTAEFKL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaagccttgaatccagtgcagtataacatcacagaagctgttcccactctggcacct
gccactactctttctctgctgctcttcatttttgtgctcatcattctatggaatcaagag
gagacatctctgataccaggcccagcttattgcatgggactcgggcccctcatttcttat
ggccgttttctactgacaggaattggcaaagcagcaaattactacaacaacatgtatgga
gaatttgtgagagtctggattaatggcgaggaaacactgattatcagcaaatcttcagca
acatttcacatcatgaaacacagccattatgtctcacgctttggaagcaagctagggcta
cagtgcattggcatgaatgaaaatggcatcatattcaatagcaacccatctctatggaag
gtcattcggccatacttcatcagagctttgtctggtccaggacttatgcaaacaacagaa
aactgtataagatctacaaatcactacctggataacctgagtaatgttacaaatgaactg
ggaaatgtagatgtccttaagctaatgaggcttattatgttagatacatcaaacaatctc
ttcctaaggatacccttagatgaaaatgaaattgttcttaagatccagaaatactttgac
gcctggcaggctctgcttctgaaaccagacatcttctttaaaatttcctggctgtacaaa
aaatatgaaaaatcagcaaatgatctgaaggaagctattgaacttctcattgaacagaaa
agacagaaactctcaagttctgagaagctggatgaggatatggatttttcatcagaactc
atatttgcccagaatcatggagatctaacagctgagaatgtcaatcagtgtattctggaa
atgctaatagctgctcccgataccatgtctgtatctctcttcttcatgttagttctgatt
gctcaacacccaaagatagaagaaggaataatgaatgaaatggataaagttattggtgac
cgggatgtagagagcaatgacattccaaatcttaaaattctggagagctttatttatgaa
agcatgaggtaccaaccagtggtagacctggttatgcgcaaggctctggaggatgatatc
attgatggttactatgtgaagaaaggcactaacatcattttaaacttggggcgcatgcac
aaaattgaatactttccaaaaccgaacgagttcaccttggaaaattttgaaaagacggtt
ccatatcgttacttccagccctttggctctggtccacgtgcatgtgccgggaagtacata
gccatggtgatgatgaaagtcattctggttactcttctcaagaggtacaaagtgcagaca
ttgagaggaagatgcctggagaatatccaaaataacaatgatttgtccatgcaccctgat
gaaagtcaaccttccttagagatgatcttcattcctaaaaacacagcagagttcaaactg
taa

DBGET integrated database retrieval system