KEGG   Xenopus laevis (African clawed frog): 373672Help
Entry
373672            CDS       T01010                                 

Gene name
kras-a, Kirsten-ras, kras, rask2
Definition
(RefSeq) Kirsten rat sarcoma viral oncogene homolog
  KO
K07827  
GTPase KRas
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
VEGF signaling pathway
Tight junction
Gap junction
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    373672 (kras-a)
   04012 ErbB signaling pathway
    373672 (kras-a)
   04370 VEGF signaling pathway
    373672 (kras-a)
   04068 FoxO signaling pathway
    373672 (kras-a)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    373672 (kras-a)
  Cellular commiunity
   04530 Tight junction
    373672 (kras-a)
   04540 Gap junction
    373672 (kras-a)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    373672 (kras-a)
   04912 GnRH signaling pathway
    373672 (kras-a)
   04914 Progesterone-mediated oocyte maturation
    373672 (kras-a)
   04916 Melanogenesis
    373672 (kras-a)
  Development
   04320 Dorso-ventral axis formation
    373672 (kras-a)
GTP-binding proteins [BR:xla04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    373672 (kras-a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 187 aa AA seqDB search
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNIKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCAL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKS
KTKCSIL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctgttggcgtaggcaagagtgccttgacg
atacagctaattcagaatcattttgtggacgaatatgatccaacaatagaggattcctac
aggaaacaagtggtgatcgatggggagacgtgtctgttggacattctggacactgcgggg
caggaggaatacagtgcaatgcgggaccagtatatgaggaccggcgagggcttcctctgt
gtctttgccattaataacatcaagtcctttgaggatattcaccattatagagagcagatc
aagcgagtgaaggattcggaggacgtgccgatggttctggtggggaacaagtgcgcatta
ccctcccggacggtggacaccaaacaagcccaggacttggccaggagttacgggattcct
tttatcgagacctcggccaaaaccagacagggcgtggacgacgctttctacacgttggtc
cgagaaatccgcaagcacaaagagaagatgagcaaagacggcaaaaagaagaagaaatca
aaaacgaagtgtagcattttgtga

DBGET integrated database retrieval system