KEGG   Xenopus laevis (African clawed frog): 373777Help
Entry
373777            CDS       T01010                                 

Gene name
cacna2d3-A
Definition
calcium channel, voltage-dependent, alpha 2/delta 3 subunit
Orthology
K04860  
voltage-dependent calcium channel alpha-2/delta-3
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xla04010]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:xla04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:xla04261]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 394 aa AA seqDB search
MPQIGTILCSFWIPFFSFSVALNVLLNGAAGSEQHIPLSMVKLWASAFGGEIKSIAAKYS
GSQLLQKSVFTKYKEFEKDVTIEEIDGLQLVKKLAKDMEEMFHKKSEAVRRLVEAAEDAH
LKHEFDADLQYEYFNAVLINEQDEDGNFLELGKEFLLLPNDHFNNLPVNVSLSDVQVPTN
VYNKDPEIVNGIYWSESLNKVFVDNFERDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVI
AFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAY
NTEIQYVEPCLNGTLVQADRNNKEHFREHLDKLYAKGIGMLNIALSEAFDLLSEFNHSGE
GSICSQAIMLVTDGAVDTYDNIFAKYNWPDRKIF
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgccccaaattggaactattctctgttctttctggattcctttcttttccttctctgtt
gccctgaatgtcttgcttaatggggcagctggatcggagcagcatatccccttatcaatg
gtaaagctctgggcctcagcatttggcggcgagatcaaatcgatagcagcaaagtactca
ggttctcagctcctgcagaagagtgtcttcacgaagtacaaggagtttgagaaggacgtg
actattgaggagatcgatgggctgcagctggttaagaagttggccaaagacatggaagaa
atgtttcataaaaaatcagaagccgtgcggagactggtggaagcggccgaggatgcgcat
ctgaaacacgagtttgatgcagatttacagtacgaatactttaacgccgttctgattaac
gaacaagatgaggacggcaacttcctagaactggggaaagagtttctgttactgcccaac
gatcacttcaacaatctgcccgtgaatgtcagtctaagtgacgtgcaagtgccaaccaac
gtctacaacaaagatccagaaatagtcaatggcatttactggtctgaatcgttaaacaag
gtttttgtggacaactttgaacgtgacccatcgttgatatggcaatatttcggaagtgca
aaaggattttttcggcagtatccaggtatcaaatgggagccggatgaaaacggagttata
gcgtttgattgccgaaaccgtaaatggtacattcaagcagccacctctccgaaggatgta
gttattttagttgacgtcagcgggagcatgaaaggtcttcgtctgacaattgcaaagcaa
actgtgtcttctattctggacaccctcggagatgatgacttcttcaacataatcgcttac
aacacagaaatccagtatgtggagccgtgtttgaacggaacgttggtgcaagcagacagg
aacaacaaggagcatttcagggaacacttggacaaactgtatgcgaaagggattggaatg
ctgaatattgccttaagtgaggcttttgacttgttaagtgagttcaaccattcaggagaa
ggaagtatttgtagtcaagccataatgcttgttaccgacggcgcggttgacacatacgac
aacatatttgccaagtacaactggccggacagaaagatcttttga

DBGET integrated database retrieval system