KEGG   Xenopus laevis (African clawed frog): 373812Help
Entry
373812            CDS       T01010                                 

Gene name
prlr-b, prlr
Definition
prolactin receptor
Orthology
K05081  
prolactin receptor
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    373812 (prlr-b)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    373812 (prlr-b)
   04060 Cytokine-cytokine receptor interaction
    373812 (prlr-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 611 aa AA seqDB search
MPQNLAPTTSSVAVTCLLFLYTVSLNAQSPPGKPEIIKCRSYEKVTFSCWWKPASDGGLP
TNYSLLYRKENDPKIYECPDYETSGLNSCYFDKAHTSFWVFYHIYVNATNALGSNVSEEL
SVDTTYIVETYPPTNLSLTVEDGHHDLLVKWHPPDMADVQSGWLTLKYEVRLKEEKEQEW
EAHSVGNQLKLKLYGLTPGGNYVVQVRCKPDSGHWSEWSQESYIQILGGGKKTDLMLWIS
VGTLSAVICLTMIWTMALKRCSVMSCILPPVPGPKIMGFDTQLLKSGKSDELLSALGCQG
FPPTSDYEDLLVEFLEVDDSKQHLMSGHDRCPQKQNINVCPAETDNNSGRGSCDSPFSHS
EDCKELCVLQPSVESTDRGIHDHWPPQSIIMDGSFTNFNDNKSNVWPDAPSTGNQISKST
YQDIKDITNLAISAMNASKHGLLIPCDDKNQLRYFKTIETIDEEENTKLSDFADLLSKGV
DADTVHLLPNEKPPFKNARSMDYVEVHKVNQNNALALIPKHNENSVRTDQYSVLVPNREY
TKVERVEGNNVLVLMQEIVNQVNPVTIEPMKLKFQQSQVANPMDMFLLVQNAESRTQAGG
MGYMDPSAFLS
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagaacttggcacctaccacctcatcagttgctgtcacatgtcttctctttctc
tacacagtgtcactgaatgcacagtccccccctgggaaacccgagatcatcaaatgccgc
tcttacgaaaaagtgaccttttcctgctggtggaaaccggcctcggatggaggacttccg
accaactacagcctcctctacagaaaagaaaatgacccaaaaatatatgaatgcccagac
tacgagacctccggcctaaactcttgctactttgacaaagcgcacacctcgttttgggtc
ttttatcacatctatgtgaatgccaccaatgccctgggcagcaatgtgtccgaagaattg
agcgtggatacgacttacatagttgagacataccctcctacaaatttgtcgcttactgtc
gaagatgggcaccatgacctgttggtgaagtggcatccaccggacatggctgatgtgcaa
tctggatggttaaccctcaagtacgaagtgcgattaaaggaagagaaagagcaggaatgg
gaggcacattcagttggcaatcaattaaaactgaagttgtatggtttaactccaggaggg
aactacgtggtccaagtccgatgcaaaccagattcagggcactggagtgaatggagccaa
gaaagttatatacagatccttggtgggggaaagaaaactgacttgatgctgtggatatca
gttggtacattatcagctgtgatttgcttgacaatgatctggactatggcattaaaaaga
tgcagtgtgatgtcttgtatattgccacctgtgccaggaccaaaaattatgggatttgac
actcagctcctaaagagtgggaaatctgatgagcttttgagtgctcttggctgtcaaggt
tttcccccaacgtccgactacgaggatcttctagtggagttcctagaagtggatgacagc
aagcagcatctcatgtcaggtcacgatcggtgtccacaaaagcagaatataaatgtctgc
ccggctgagacagacaataactccggaagaggaagctgtgacagccccttttcccattcc
gaagattgtaaagagctgtgtgttctacagccaagcgtcgaaagtacagacagagggatc
catgaccactggccacctcagagtataataatggatggatcctttacaaattttaatgac
aataagtcaaacgtgtggccagatgctccatcaactggaaaccaaatttctaaatcgacc
tatcaggatataaaagatattactaatctggctattagtgccatgaatgccagcaagcat
gggcttttaattccatgtgatgacaagaaccagctaagatactttaaaaccatagagacc
attgatgaagaagagaatacaaagcttagtgattttgcagacttgctatccaaaggtgtt
gacgccgacacagtgcacttgttgcccaatgaaaagcctccctttaagaatgctagaagt
atggactacgtggaagtccacaaagtcaaccaaaataatgcactagcactcataccaaaa
cacaatgaaaacagcgtcaggactgaccaatattctgttcttgttcccaacagagaatat
acaaaagtcgaaagggtggagggtaacaacgttttagtgttaatgcaagaaatagttaac
caggtaaatcctgtaaccatcgaaccaatgaaattgaagtttcagcaaagccaagtggcg
aatccaatggacatgttcttgctggtgcagaatgcagaaagtcgaactcaggctggtggg
atgggttacatggatccttcagcttttctctcttaa

DBGET integrated database retrieval system