KEGG   Xenopus laevis (African clawed frog): 378602Help
Entry
378602            CDS       T01010                                 

Gene name
gck, gck-A, glk, hhf3, hk4, hkiv, hxkp, mody2
Definition
glucokinase (hexokinase 4) (EC:2.7.1.2)
Orthology
K12407  
glucokinase [EC:2.7.1.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    378602 (gck)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    378602 (gck)
   00052 Galactose metabolism
    378602 (gck)
   00500 Starch and sucrose metabolism
    378602 (gck)
   00520 Amino sugar and nucleotide sugar metabolism
    378602 (gck)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    378602 (gck)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    378602 (gck)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     378602 (gck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 458 aa AA seqDB search
METFDQNEVDQILSEFHLQEEDLHVLMCRMQAEMERGLHLETNEEASVKMLPTYVRSTPD
GSEVGDFLALDLGGTNFRVMLVKVGEDLEGQWKVETKHKMYSIPVDAMTGTAEMLFDYIA
ECISDYLDQQNMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRD
AIKRRGDFEMDVVAMVNDTVATMISCYYEDHHCEVGLIVGTGCNACYMEEMSNVELVEGE
EGRMCVNTEWGAFGDTGELEDFRLEYDRVVDEASLNPGQQLYEKMIGGKYMGELVRLVLI
KMVNENLLFGGESSEKLKTRGAFETQFVSQIEADTSDFKQTLNILRTLGVQATIGDCHAV
RLACESVSTRAAIMCSAGLAGILNRMRQSRREELLRITVGVDGSVYKLHPSFKDKFHATV
LKLTSGCEITFIQSEEGSGRGAALISAVAYKMAVMIGH
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggaaacatttgaccagaatgaggtggatcagatcctgtctgagttccatctgcaggag
gaagatttgcatgttctgatgtgcaggatgcaggctgagatggagaggggtcttcacctg
gaaaccaatgaggaggccagtgttaaaatgctgcccacctatgttcgctcaacacctgat
ggctctgaggtgggtgacttcctagccctggaccttgggggcaccaacttccgtgtcatg
ttggtaaaggttggggaggatttggaagggcagtggaaagtggagacaaaacacaaaatg
tattcaattccagtggatgccatgactggaacagcagagatgctatttgactacattgca
gaatgcatttctgattacctggaccagcaaaacatgaagcacaagaaactgcccttggga
tttactttctctttcccggttagacatgaggatatcgacaagggtattcttctcaattgg
accaaaggattcaaagcatctggagcagaaggaaacaatgttgttggacttctcagagat
gcaatcaagagacgtggtgattttgaaatggatgtggttgccatggtaaatgatacagtg
gctactatgatatcttgttactatgaagaccatcactgtgaggttggcttgatcgtaggg
actggctgcaacgcttgctacatggaggagatgagtaatgtggagctggtggaaggagag
gagggacgtatgtgtgtgaacacggagtggggagcatttggagacacgggggagctggag
gatttccgactagagtacgaccgagtggtggatgaggcatctcttaatcctggtcagcaa
ctctacgaaaagatgattggtggaaaatacatgggggagctggtcagactggtcctgata
aagatggtgaatgagaatctgttatttggaggagaatcttctgaaaagctgaagacccga
ggagccttcgaaacacaatttgtgtcccagatagaggcggacacctccgattttaaacag
actctcaacatcctgcggactctaggagtacaggccacaattggagactgtcatgctgtg
cgcttagcatgtgagagtgtatctactcgagctgccatcatgtgttctgctggccttgct
gggatactaaaccgcatgcggcaaagcaggagagaggagctacttcgaattactgtggga
gtggatggatctgtgtacaaactacaccctagttttaaggacaagttccatgccactgtg
ctcaaactgacttcaggctgtgaaattaccttcattcagtcagaggaaggaagtggacgt
ggagctgccctaatatcagcagtggcgtataagatggctgtcatgattggtcactag

DBGET integrated database retrieval system