KEGG   Xenopus laevis (African clawed frog): 378610Help
Entry
378610            CDS       T01010                                 

Gene name
adcy9, xlAC
Definition
adenylate cyclase 9 (EC:4.6.1.1)
Orthology
K08049  
adenylate cyclase 9 [EC:4.6.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Purine metabolism
Calcium signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:xla00230]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:xla04020]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xla04114]
Cellular Processes; Cell communication; Gap junction [PATH:xla04540]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:xla04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
Organismal Systems; Endocrine system; Melanogenesis [PATH:xla04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:xla04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:xla04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1355 aa AA seqDB search
MEIQVTGVSGQARSCQNPSVCLKFTAGGVSRGGGGELVGGKVPDKLYINNMASPVNQQLL
HHTEVRCDGSGDGSSVTVRINRQHHQAPSRRCKYSISSSCSSGESGVKKTGGSGGARRQK
KLPQLFERSTSNWWNPKFDSNNLEEACVERCFPQTQRRFRYALMYLSVAGLLWSIYFSVH
MKTKLVSHLVPTLCFLIVCLGFFFFTFTKSYARHCTAISLLVTLLVFTLTLASQFQVLNP
GLGSDSLSNLTSFSATGSSSCLSQVGSFSICVEVLLLLYTVMHLPLYLSACLGVAYSILF
ETFGYHFRDESCFVLLVGRMAHWELLSKALLHVCIHAIGVHLFIMSEVRSRSTFLKVGQS
IMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDDESENSVKRHSASSPKSRKKKSSIQ
KTPIIFRPFKMQRIEQVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEETKCE
KISTLGDCYYCVAGCPEPRPDHAYCCIEMGLGMIEAIDQFCQEKKEMVNMRVGVHTGTVL
CGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEKTARYLDDRYLMEDSMVVERLGQ
IVAADQLKGLKTFLISGGRTRVPSCSCSQTLIPVQEGTDLSSPSLAPHVQAAISETSDSH
TNCTQPETLKSCPSCGETAARDGPEEGVSAANGGGEEWKGGAPRPSAIGASLKDPERSPE
SSTGDTLTNSQASLYDMLQEKGRWCGVSMDQSALLPLRFKNIREKTDAHFVEVIKEDSLM
KDYFFKPPINPLSLNFLDKELETSYRASYQEEVIRMAPVKTFASATFSSLQDVLLNYFIF
VLLSVACLLKPGTNTVSPPTLALVLLSVCGLLGFLSLLVSVRMAFYLEDMLLCTRRLLEI
ISGWVPRHFIGTVLVCLPAAVIFSYLSSDFYTDIHYTMFLCSALLIPMVQYCNFCQLSSS
ALLLATITGATMLILIYLPLCPQRPPLDPGTDIEANLSTSNSSYETLDNPRTELPFTRLG
QEIAVAYFLLLLLVWFLNREFDVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYH
VAEQLKVSQSYSKNHDDAGVIFASIVNFSEFYEENYEGGKECYRALNELIGDFDELLSKP
HYSCIEKIKTIGATYMAASGLNPSQCQDSSQPHRHLQTLFEFAKEMMSVVDEFNNNMLWF
NFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQASEESYRVLVKM
GYDFDYRGTVNVKGKGQMKTYHFPKCTDNGGLVPHHQLCISPDIRVQVDGSIGRSPTDEI
SSLVTGGKGAVELGSGEAERKREKAEERGRDGGAR
NT seq 4068 nt NT seq  +upstreamnt  +downstreamnt
atggagatacaagtgactggagtctcagggcaagctagaagctgtcaaaacccttctgtt
tgtctgaagtttacagcaggaggggttagtagaggtggtggaggggagttggtaggggga
aaagtcccagacaaactctatatcaacaacatggcttcccctgtgaaccagcagctgctg
catcataccgaggttaggtgtgatggcagcggggacggcagtagcgtgaccgttagaatc
aataggcagcaccaccaagcgccatccagacgttgcaagtacagtatttcatccagctgc
agttccggagagtctggagttaaaaagactggaggctctgggggtgcccgaaggcaaaaa
aagctccctcagttgtttgagaggtccacatcaaactggtggaaccctaaatttgattcc
aataacctagaggaagcctgtgtggaaaggtgcttccctcagacccagcgcaggttccgt
tatgctctcatgtacctctctgtagcagggctgctgtggagcatctactttagtgtccac
atgaagaccaagcttgttagtcacttggtacctaccctgtgcttccttatagtgtgccta
ggattctttttcttcacctttacaaagtcttatgcccgccattgcacagcaatctccttg
cttgttactctgctggtttttacgctgactttggcttctcagttccaagtgctaaaccct
ggattagggagtgacagtctctcaaaccttacatccttttcagcaacaggttcatcctct
tgcctctctcaggtgggcagtttctccatatgtgtggaagtcctgcttctcctctacaca
gtcatgcacttgcctctgtacctcagtgcctgccttggtgttgcttactcaattctgttt
gaaacatttggatatcactttagagatgaaagctgttttgttctgttagtgggtaggatg
gcccactgggagcttctcagcaaggcactgttgcatgtttgcattcatgctataggtgtt
catcttttcataatgtctgaggtccgatctcgtagcaccttcttaaaagttggccagtcc
attatgcatggcaaggacttggaagtggaaaaagcacttaaagagagaatgattcattca
gttatgccaagaatcattgcagatgacttaatgaaacagggagatgatgaaagtgaaaac
tctgtgaagcgccactcagcctccagccctaaaagccgtaaaaagaagtcctctattcag
aaaacacctataatctttagacctttcaagatgcagaggattgagcaggtgagcattctt
tttgcagacattgttggatttaccaagatgagtgctaacaagtcagctcatgccttagta
ggactcctcaatgacctttttggtcgctttgaccgcctgtgcgaggagacaaaatgtgaa
aaaattagcactcttggcgattgctattattgtgtggcagggtgccctgagccaagacca
gaccatgcttattgctgcattgagatggggcttggtatgatcgaggcaattgaccaattt
tgccaggaaaagaaggagatggttaacatgcgtgttggtgtacacactggtacggttctt
tgtggtatccttggaatgagaaggttcaagttcgatgtatggtcaaatgatgtcaacctg
gctaacctgatggaacagcttggagttgctggcaaagtgcatatttctgagaaaactgct
agatacctggatgatcgctacttaatggaggacagtatggtggtcgaacgtttaggacag
attgtggcagctgatcagctaaaaggattaaagacattcctgatctccgggggcagaact
cgtgtgcccagctgcagctgctcccagaccctgattccggtgcaagaggggaccgacctc
agcagcccttccttagccccccacgtccaagcggcaatcagcgagaccagcgacagtcac
actaactgcactcagccagagacactcaagagctgtccttcctgtggagaaaccgccgcc
cgagatggccctgaagaaggcgtgtctgctgccaatgggggtggtgaagaatggaaagga
ggagccccgcggccttctgccattggggcgtcacttaaagacccagaacggtctcctgag
tcctccaccggagacactcttaccaacagccaggcttcactctatgatatgctccaagag
aagggtcgctggtgtggcgtcagtatggaccagtcggctctgcttcctctccgctttaag
aacatccgagagaagaccgacgcacactttgtggaagttatcaaggaagacagcctgatg
aaagattacttcttcaagccgcctataaatccactcagcctgaattttctggacaaggag
ctggagacgtcataccgagccagctatcaggaggaggttatacggatggctccagtgaag
acctttgccagtgccacattcagctccttgcaggacgtactccttaactacttcatcttt
gtacttctctctgtggcttgtttactgaagccgggcacaaatactgtgtctcctccaact
ctggcactggtgctactgtctgtctgtggcctcttgggcttcctctcactgctggtttct
gtcaggatggcattttaccttgaggacatgctgctgtgtaccagacgtctcctggagatc
atctccggttgggtccctcggcatttcattggcactgtcctcgtgtgtctcccagcagct
gtcatcttctcgtacctctcttctgacttctacaccgacatacactacacaatgttcctg
tgttcagcccttctcatcccgatggttcagtactgtaacttctgccaactcagctcctcc
gcgctcctacttgccaccataacaggcgccaccatgctcatcctcatctacctgcccttg
tgcccacaaaggcctccgctggatcctgggacagacattgaagcaaatttaagcacatcc
aattcatcctatgagactctggacaaccccagaactgagctcccattcactcgcctcggt
caagaaatagctgtagcctactttctcctcctcctcctggtgtggttcctgaaccgtgag
tttgatgtcagctatcgactacattatcatggagatgtcgaggccgatctccatcgcacc
aaaatccagagcatgagagaccaagcggactggctcctgcgaaacataatcccttaccat
gtggccgagcaactgaaggtctcacagagctactccaagaaccatgatgatgcaggtgtc
atctttgccagcatagtcaacttcagtgagttctatgaggaaaactacgagggaggaaag
gaatgctaccgcgctcttaatgaacttattggggacttcgatgagctccttagcaaaccg
cattactcctgtattgagaaaattaaaactattggagctacatacatggctgcttcagga
cttaacccgtcccaatgtcaagacagcagccaaccgcaccgccacctgcagaccctcttt
gagtttgccaaggaaatgatgagtgtggtggacgaatttaacaacaatatgctatggttt
aacttcaagttacgcattggctttaaccatgggccactgacggctggtgtgattgggacc
accaaacttctgtatgatatctggggggacacagtgaacattgccagcagaatggacacg
acaggcgtggagtgccgtatccaggctagtgaggaaagctacagagtgctggtcaaaatg
ggttacgattttgattatagggggacggtcaacgtcaaggggaaaggacagatgaagacc
taccatttccccaagtgtacagacaatggtggtcttgtcccgcaccaccagctgtgcatc
tctcctgacatccgtgttcaggtagatggaagcattggccgctctcccactgatgaaata
agtagcttggtgacaggaggaaaaggggcagtagaattgggaagtggagaagctgaacgc
aaaagagaaaaggcagaagagaggggccgtgatggcggagcacggtga

DBGET integrated database retrieval system