KEGG   Xenopus laevis (African clawed frog): 378610Help
Entry
378610            CDS       T01010                                 

Gene name
adcy9, xlAC
Definition
adenylate cyclase 9 (EC:4.6.1.1)
Orthology
K08049  
adenylate cyclase 9 [EC:4.6.1.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Purine metabolism
Calcium signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    378610 (adcy9)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    378610 (adcy9)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    378610 (adcy9)
  Cellular commiunity
   04540 Gap junction
    378610 (adcy9)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    378610 (adcy9)
   04914 Progesterone-mediated oocyte maturation
    378610 (adcy9)
   04916 Melanogenesis
    378610 (adcy9)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    378610 (adcy9)
   04270 Vascular smooth muscle contraction
    378610 (adcy9)
Enzymes [BR:xla01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     378610 (adcy9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 1355 aa AA seqDB search
MEIQVTGVSGQARSCQNPSVCLKFTAGGVSRGGGGELVGGKVPDKLYINNMASPVNQQLL
HHTEVRCDGSGDGSSVTVRINRQHHQAPSRRCKYSISSSCSSGESGVKKTGGSGGARRQK
KLPQLFERSTSNWWNPKFDSNNLEEACVERCFPQTQRRFRYALMYLSVAGLLWSIYFSVH
MKTKLVSHLVPTLCFLIVCLGFFFFTFTKSYARHCTAISLLVTLLVFTLTLASQFQVLNP
GLGSDSLSNLTSFSATGSSSCLSQVGSFSICVEVLLLLYTVMHLPLYLSACLGVAYSILF
ETFGYHFRDESCFVLLVGRMAHWELLSKALLHVCIHAIGVHLFIMSEVRSRSTFLKVGQS
IMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDDESENSVKRHSASSPKSRKKKSSIQ
KTPIIFRPFKMQRIEQVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEETKCE
KISTLGDCYYCVAGCPEPRPDHAYCCIEMGLGMIEAIDQFCQEKKEMVNMRVGVHTGTVL
CGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEKTARYLDDRYLMEDSMVVERLGQ
IVAADQLKGLKTFLISGGRTRVPSCSCSQTLIPVQEGTDLSSPSLAPHVQAAISETSDSH
TNCTQPETLKSCPSCGETAARDGPEEGVSAANGGGEEWKGGAPRPSAIGASLKDPERSPE
SSTGDTLTNSQASLYDMLQEKGRWCGVSMDQSALLPLRFKNIREKTDAHFVEVIKEDSLM
KDYFFKPPINPLSLNFLDKELETSYRASYQEEVIRMAPVKTFASATFSSLQDVLLNYFIF
VLLSVACLLKPGTNTVSPPTLALVLLSVCGLLGFLSLLVSVRMAFYLEDMLLCTRRLLEI
ISGWVPRHFIGTVLVCLPAAVIFSYLSSDFYTDIHYTMFLCSALLIPMVQYCNFCQLSSS
ALLLATITGATMLILIYLPLCPQRPPLDPGTDIEANLSTSNSSYETLDNPRTELPFTRLG
QEIAVAYFLLLLLVWFLNREFDVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYH
VAEQLKVSQSYSKNHDDAGVIFASIVNFSEFYEENYEGGKECYRALNELIGDFDELLSKP
HYSCIEKIKTIGATYMAASGLNPSQCQDSSQPHRHLQTLFEFAKEMMSVVDEFNNNMLWF
NFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQASEESYRVLVKM
GYDFDYRGTVNVKGKGQMKTYHFPKCTDNGGLVPHHQLCISPDIRVQVDGSIGRSPTDEI
SSLVTGGKGAVELGSGEAERKREKAEERGRDGGAR
NT seq 4068 nt NT seq  +upstreamnt  +downstreamnt
atggagatacaagtgactggagtctcagggcaagctagaagctgtcaaaacccttctgtt
tgtctgaagtttacagcaggaggggttagtagaggtggtggaggggagttggtaggggga
aaagtcccagacaaactctatatcaacaacatggcttcccctgtgaaccagcagctgctg
catcataccgaggttaggtgtgatggcagcggggacggcagtagcgtgaccgttagaatc
aataggcagcaccaccaagcgccatccagacgttgcaagtacagtatttcatccagctgc
agttccggagagtctggagttaaaaagactggaggctctgggggtgcccgaaggcaaaaa
aagctccctcagttgtttgagaggtccacatcaaactggtggaaccctaaatttgattcc
aataacctagaggaagcctgtgtggaaaggtgcttccctcagacccagcgcaggttccgt
tatgctctcatgtacctctctgtagcagggctgctgtggagcatctactttagtgtccac
atgaagaccaagcttgttagtcacttggtacctaccctgtgcttccttatagtgtgccta
ggattctttttcttcacctttacaaagtcttatgcccgccattgcacagcaatctccttg
cttgttactctgctggtttttacgctgactttggcttctcagttccaagtgctaaaccct
ggattagggagtgacagtctctcaaaccttacatccttttcagcaacaggttcatcctct
tgcctctctcaggtgggcagtttctccatatgtgtggaagtcctgcttctcctctacaca
gtcatgcacttgcctctgtacctcagtgcctgccttggtgttgcttactcaattctgttt
gaaacatttggatatcactttagagatgaaagctgttttgttctgttagtgggtaggatg
gcccactgggagcttctcagcaaggcactgttgcatgtttgcattcatgctataggtgtt
catcttttcataatgtctgaggtccgatctcgtagcaccttcttaaaagttggccagtcc
attatgcatggcaaggacttggaagtggaaaaagcacttaaagagagaatgattcattca
gttatgccaagaatcattgcagatgacttaatgaaacagggagatgatgaaagtgaaaac
tctgtgaagcgccactcagcctccagccctaaaagccgtaaaaagaagtcctctattcag
aaaacacctataatctttagacctttcaagatgcagaggattgagcaggtgagcattctt
tttgcagacattgttggatttaccaagatgagtgctaacaagtcagctcatgccttagta
ggactcctcaatgacctttttggtcgctttgaccgcctgtgcgaggagacaaaatgtgaa
aaaattagcactcttggcgattgctattattgtgtggcagggtgccctgagccaagacca
gaccatgcttattgctgcattgagatggggcttggtatgatcgaggcaattgaccaattt
tgccaggaaaagaaggagatggttaacatgcgtgttggtgtacacactggtacggttctt
tgtggtatccttggaatgagaaggttcaagttcgatgtatggtcaaatgatgtcaacctg
gctaacctgatggaacagcttggagttgctggcaaagtgcatatttctgagaaaactgct
agatacctggatgatcgctacttaatggaggacagtatggtggtcgaacgtttaggacag
attgtggcagctgatcagctaaaaggattaaagacattcctgatctccgggggcagaact
cgtgtgcccagctgcagctgctcccagaccctgattccggtgcaagaggggaccgacctc
agcagcccttccttagccccccacgtccaagcggcaatcagcgagaccagcgacagtcac
actaactgcactcagccagagacactcaagagctgtccttcctgtggagaaaccgccgcc
cgagatggccctgaagaaggcgtgtctgctgccaatgggggtggtgaagaatggaaagga
ggagccccgcggccttctgccattggggcgtcacttaaagacccagaacggtctcctgag
tcctccaccggagacactcttaccaacagccaggcttcactctatgatatgctccaagag
aagggtcgctggtgtggcgtcagtatggaccagtcggctctgcttcctctccgctttaag
aacatccgagagaagaccgacgcacactttgtggaagttatcaaggaagacagcctgatg
aaagattacttcttcaagccgcctataaatccactcagcctgaattttctggacaaggag
ctggagacgtcataccgagccagctatcaggaggaggttatacggatggctccagtgaag
acctttgccagtgccacattcagctccttgcaggacgtactccttaactacttcatcttt
gtacttctctctgtggcttgtttactgaagccgggcacaaatactgtgtctcctccaact
ctggcactggtgctactgtctgtctgtggcctcttgggcttcctctcactgctggtttct
gtcaggatggcattttaccttgaggacatgctgctgtgtaccagacgtctcctggagatc
atctccggttgggtccctcggcatttcattggcactgtcctcgtgtgtctcccagcagct
gtcatcttctcgtacctctcttctgacttctacaccgacatacactacacaatgttcctg
tgttcagcccttctcatcccgatggttcagtactgtaacttctgccaactcagctcctcc
gcgctcctacttgccaccataacaggcgccaccatgctcatcctcatctacctgcccttg
tgcccacaaaggcctccgctggatcctgggacagacattgaagcaaatttaagcacatcc
aattcatcctatgagactctggacaaccccagaactgagctcccattcactcgcctcggt
caagaaatagctgtagcctactttctcctcctcctcctggtgtggttcctgaaccgtgag
tttgatgtcagctatcgactacattatcatggagatgtcgaggccgatctccatcgcacc
aaaatccagagcatgagagaccaagcggactggctcctgcgaaacataatcccttaccat
gtggccgagcaactgaaggtctcacagagctactccaagaaccatgatgatgcaggtgtc
atctttgccagcatagtcaacttcagtgagttctatgaggaaaactacgagggaggaaag
gaatgctaccgcgctcttaatgaacttattggggacttcgatgagctccttagcaaaccg
cattactcctgtattgagaaaattaaaactattggagctacatacatggctgcttcagga
cttaacccgtcccaatgtcaagacagcagccaaccgcaccgccacctgcagaccctcttt
gagtttgccaaggaaatgatgagtgtggtggacgaatttaacaacaatatgctatggttt
aacttcaagttacgcattggctttaaccatgggccactgacggctggtgtgattgggacc
accaaacttctgtatgatatctggggggacacagtgaacattgccagcagaatggacacg
acaggcgtggagtgccgtatccaggctagtgaggaaagctacagagtgctggtcaaaatg
ggttacgattttgattatagggggacggtcaacgtcaaggggaaaggacagatgaagacc
taccatttccccaagtgtacagacaatggtggtcttgtcccgcaccaccagctgtgcatc
tctcctgacatccgtgttcaggtagatggaagcattggccgctctcccactgatgaaata
agtagcttggtgacaggaggaaaaggggcagtagaattgggaagtggagaagctgaacgc
aaaagagaaaaggcagaagagaggggccgtgatggcggagcacggtga

DBGET integrated database retrieval system