KEGG   Xenopus laevis (African clawed frog): 378615Help
Entry
378615            CDS       T01010                                 

Gene name
hdac9, MITR, hdac9-A
Definition
histone deacetylase 9 (EC:3.5.1.98)
Orthology
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     378615 (hdac9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 565 aa AA seqDB search
MIGKDIKSEFPIGLESISPLDLRTDLRTAVPVGDPGLREKQLQQELLIIKQQQQIQKQLL
IAEFQKQHENLTRQHQVQLQEHLKLQQELLAMKQQQELLEREKEQKMEQQRKEQEAERHR
QEQQLCHPRSKDRVKERAVASTEVKQKLQEFILSKSATKEPLTNGTSHSMGRHPKLWYTA
AHHTSLDQSSPPPSGTSPTYKCPPPGNQDDFPLRKTASEPNLKVRSRLKQKVVERRSSPL
LRRKDSIVSSSYKKRIFEVAESSVSSSSPVSGPSSPNNGPVAMEAEHETPVLSVNSRIEN
LVSHHHLVHHERSLSLLNLYTSPSLPNITLGLHATATQLNTSSSLKEQQKYDPQAPRQGV
SMAGQYAGGIPTSSNHVSLEGKANSHQAILQHLLLKEQMRQQKILASGGTPVLHQSPLAA
KDRVSPAGRVAHKLPRHRPLHRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNK
ILSKSIEQLRQPEGHLEEAEEDLHGDNLMQEKSSSIDNTRSYSSTDLRTGPFGSVKVKEE
PPDSENEIKTHLQSEQKSVFAQQVT
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaaagatataaagtctgaatttcccattggcctggagtccatctccccttta
gacttaaggactgatcttaggacagcagtgcctgttggtgatccaggtctgagagagaaa
cagctgcagcaggagcttctgataattaaacagcagcagcaaatccagaagcaacttcta
attgcagagtttcagaagcagcatgaaaacctcacaaggcaacaccaggtccagctccag
gagcacctcaagctgcagcaagaacttttagcaatgaagcaacagcaagagctcttggag
agagagaaggaacagaaaatggagcagcagagaaaagaacaggaagcagaaaggcatcgc
caggagcagcaattgtgtcaccctcgaagcaaagacagggtgaaagaaagggcagtagcc
agtacagaggtgaaacagaagctccaagagttcatactgagtaagtctgcaactaaagaa
cctttgacaaacggaaccagtcattccatgggacgccacccgaagctttggtacacagca
gcacatcatacatcactggatcaaagctcgcctccgcctagtggtacgtcgccaacatat
aaatgtcctccaccaggaaatcaagacgacttccctttaaggaaaacagcatcagaaccc
aacttgaaagttcggtcccgtttgaaacagaaagtagtggagagacggagcagcccttta
ctgagaaggaaggacagcattgtttccagctcatacaagaagagaatatttgaggttgca
gaatcttcggtgagtagcagctctccagtatctggacccagctcaccaaataatggtcca
gtcgccatggaagcagaacatgaaacgcctgtcttgtcagtgaattcccgtatagagaat
ttggtttcacatcatcatcttgtgcatcatgaaagatctttaagtctcctaaacctgtat
acatctccttctttgccgaatattactttaggactgcatgcgacagctactcagcttaat
acctcatcttcattaaaagagcaacaaaagtacgacccgcaggcaccccggcagggggtt
tcaatggccggacagtacgccggaggcattccaacatcctcaaatcatgtttccctggaa
ggaaaggccaatagtcaccaggccatactgcaacacctactgctgaaagaacagatgcgt
cagcagaagattttagcttcaggtgggacaccagttctacatcagtcacctctggcagca
aaggacagagtttcaccagccgggagagtagcccacaaactgcctcgtcacaggcccctt
caccgaacccaatctgctcctctgccccagagtaccctggctcaactggttatccaacag
cagcaccagcagttcttggagaagcagaaacaatatcagcagcagattcacatgaacaaa
atactttccaaatctattgaacaacttcgacaacccgaagggcatcttgaagaagctgag
gaagatcttcatggagataatttgatgcaagaaaagagttcctccattgataacacaaga
agttacagcagtacagatcttaggactggaccttttggatctgtgaaagtgaaagaggag
ccaccagatagtgagaatgaaattaaaacacatcttcagtctgagcagaagtcagttttt
gcgcaacaggtaacctga

DBGET integrated database retrieval system