KEGG   Xenopus laevis (African clawed frog): 378695Help
Entry
378695            CDS       T01010                                 

Gene name
ins-b, igf2-A, ins, ins1, xins
Definition
insulin
Orthology
K04526  
insulin
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Oocyte meiosis
Regulation of autophagy
mTOR signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    378695 (ins-b)
   04150 mTOR signaling pathway
    378695 (ins-b)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    378695 (ins-b)
  Cell motility
   04810 Regulation of actin cytoskeleton
    378695 (ins-b)
  Cell growth and death
   04114 Oocyte meiosis
    378695 (ins-b)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    378695 (ins-b)
   04914 Progesterone-mediated oocyte maturation
    378695 (ins-b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 106 aa AA seqDB search
MALWMQCLPLVLVLLFSTPNTEALANQHLCGSHLVEALYLVCGDRGFFYYPKIKRDIEQA
QVNGPQDNELDGMQFQPQEYQKMKRGIVEQCCHSTCSLFQLENYCN
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggctctatggatgcagtgtctgcccctggttcttgtcctccttttctctacacccaac
accgaagctctagccaaccagcacttgtgtgggtctcacctagtagaagccctgtaccta
gtatgtggggatagaggcttcttctactaccctaagatcaaacgggacatcgaacaagca
caggtcaatggaccccaggacaacgagttagatggaatgcagttccagcctcaagagtat
cagaaaatgaagagggggattgtggagcaatgctgccacagcacatgttctctcttccag
ctggagaactactgcaactag

DBGET integrated database retrieval system