KEGG   Xenopus laevis (African clawed frog): 378695Help
Entry
378695            CDS       T01010                                 

Gene name
ins-b, igf2-A, ins, ins1, xins
Definition
insulin
Orthology
K04526  
insulin
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Oocyte meiosis
Regulation of autophagy
mTOR signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xla04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:xla04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:xla04140]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:xla04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xla04114]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:xla04910]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 106 aa AA seqDB search
MALWMQCLPLVLVLLFSTPNTEALANQHLCGSHLVEALYLVCGDRGFFYYPKIKRDIEQA
QVNGPQDNELDGMQFQPQEYQKMKRGIVEQCCHSTCSLFQLENYCN
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggctctatggatgcagtgtctgcccctggttcttgtcctccttttctctacacccaac
accgaagctctagccaaccagcacttgtgtgggtctcacctagtagaagccctgtaccta
gtatgtggggatagaggcttcttctactaccctaagatcaaacgggacatcgaacaagca
caggtcaatggaccccaggacaacgagttagatggaatgcagttccagcctcaagagtat
cagaaaatgaagagggggattgtggagcaatgctgccacagcacatgttctctcttccag
ctggagaactactgcaactag

DBGET integrated database retrieval system