KEGG   Xenopus laevis (African clawed frog): 379048Help
Entry
379048            CDS       T01010                                 

Gene name
ccnb3, ccnb3-a
Definition
cyclin B3
Orthology
K05868  
cyclin B
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
Progesterone-mediated oocyte maturation
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:xla04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:xla04110]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:xla04115]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 416 aa AA seqDB search
MMPSLRPSRPVASKLPKLGKPVTAENNRLDKVEISQTKRSPSSPQGGAKKRAAFGDITNA
HKNPQLIQKKKEGQKVAIKKTKSAPTSDITKNNELNIKKTQKKATVTEEHLPEVKEEKIN
TEQKTSVPTKEIPEEKVLPPGVEDIDQDSLDDPFSNSEYATDIFSYMRDREEKFLLPNYL
EMQTDISKDMRAILVDWMVEVQENFELNHETLYLAVKMVDHYLAVSVVMKEKLQLIGSTA
VLIASKFEERCPPCVDDFMYICDDAYKRDEVIAMEMEILQKLYFDINIPVPYRFLRRFAK
CAHATMETLTLARYICELTLQEYDFVQERASKMAASCLLLALQMKGLGRWTATLHYYSGY
QTNDLLPLVKRLNFLLTYPPNKKLKAVRSKYSHRVFFEVAKLPPMDMLTLTEALQS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgatgccttctcttcgtccatctcggccagtggcttccaaacttccgaaactggggaag
ccggttactgcagagaataatcgacttgataaggtggagatcagtcagacaaagcgttct
ccttcctctccacagggaggcgcaaagaagagagcagcatttggagacattaccaatgct
cacaaaaacccacaactaattcagaagaagaaggagggacagaaagttgccatcaagaag
accaaaagtgctcccacaagtgacattacaaagaataatgagctcaatatcaagaagact
cagaagaaggccacagtaactgaagaacatctccctgaagtaaaagaagaaaaaataaac
actgagcagaaaacatcagtacctaccaaggaaatacctgaggaaaaggttcttccacct
ggtgttgaggacatagaccaggactctcttgacgaccccttctctaactctgaatatgca
acggatattttcagctatatgcgggacagagaggagaaatttctgcttccaaactacctg
gagatgcaaacagatattagcaaggatatgagggctatccttgtggattggatggtggag
gtgcaggaaaactttgagcttaaccatgaaaccctatacctggcagtgaaaatggtcgac
cattatttagcagtgtctgtcgtcatgaaggagaagcttcagcttattggttccactgct
gtactcattgcatctaagttcgaggagcgttgcccaccctgtgtcgacgatttcatgtac
atctgtgatgatgcatacaaaagggatgaggttattgctatggagatggaaatcctgcaa
aaactctactttgacatcaacattccggtcccataccgcttcctgcgcagatttgctaag
tgtgcccatgccaccatggagactctgacccttgccagatacatttgtgaactgacccta
caggaatatgactttgtgcaggagcgtgcatctaagatggctgccagctgcctgttgctt
gctcttcaaatgaaggggttgggcagatggactgccacactacattattacagtgggtat
cagaccaatgatttattgcccctagtgaagaggctgaatttcctactcacatatcctccc
aacaagaagttaaaggcagtgaggagcaaatactcacacagggtcttctttgaagtggca
aaattgccccccatggacatgctaacacttacagaggcccttcagagctaa

DBGET integrated database retrieval system