KEGG   Xenopus laevis (African clawed frog): 379123Help
Entry
379123            CDS       T01010                                 

Gene name
srd5a3, S5AR_3, SRD5alpha3
Definition
steroid 5 alpha-reductase 3 (EC:1.3.1.22 1.3.1.94)
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    379123 (srd5a3)
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     379123 (srd5a3)
    1.3.1.94  polyprenol reductase
     379123 (srd5a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 319 aa AA seqDB search
MQLVQLLPPGVSLLALVWLAVDAAFLTALLLYLQRGCDSGRSLLCSVFQDLIRYGKTKSG
LRRPSWLQWFDIPKRCFWHFYFVSLVWNGFLLWILLHLLLQSVPVPEWLQAVLQFLCAGS
EPQVLGGELSVVLAFSLLWLHSLRRLLECLFVSIFSNGVIHFVQYCFGLGYYILIGFTIL
GYCPLDRRTAVSLDDLLMQGNWYHILGLTLYVWASLHQYTCHCILADLRKSASGAIINLK
HAVPTGDWFEKVSCPHYFAELLIYLSIAVVFGLLNTIWWLVVLYVLLSQALAAVLCHEFY
HEKFDSYPIHRKAFIPLIF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttgtgcagctgcttccgccaggagtgagcttgttggctctagtgtggctggcg
gtggatgcggccttccttactgccctgctcttatatctgcaacgaggctgcgacagcggg
cgctcccttttgtgcagcgtcttccaagatctcattcgctatgggaagactaaaagcggc
ttgcggcgcccctcatggctccagtggtttgatatacctaagaggtgcttctggcatttt
tattttgtctctctggtctggaatgggtttctcctgtggatcctccttcacttactgctc
caaagtgtcccagttccagaatggctacaagcagtgctacagttcctctgtgccggatca
gaaccacaagtcctgggcggagaactttcagttgttctggctttttctctgttgtggttg
cacagcctgcggagattgctagagtgcctgtttgtgagtatcttctccaatggggtcatt
cactttgtgcagtattgcttcggcttgggctattacatcttgattgggttcactatactc
ggctattgccctctggacagaaggaccgcagtttcgctggatgatctcctaatgcagggt
aactggtaccatatccttggactgacactctatgtctgggcttctctacaccagtacaca
tgtcattgtattcttgctgatctgaggaaaagtgcatcaggtgccataataaacctgaag
catgctgtacctactggagactggtttgagaaggtgtcctgccctcattactttgcagag
ctcttgatctacctgtctatcgcagttgtttttggacttctgaatactatatggtggttg
gttgttttatatgtgttgctaagccaggcattggctgcggttttatgtcatgagttttat
catgaaaagtttgattcctatcctattcacaggaaagcattcattccacttatattttaa

DBGET integrated database retrieval system