KEGG   Xenopus laevis (African clawed frog): 379198Help
Entry
379198            CDS       T01010                                 

Gene name
arg2-a, arg1, arg2, arg2-b, arg3
Definition
arginase 2 (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:xla01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:xla00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 360 aa AA seqDB search
MSIRSNFVRLLKKQVSIIKLQKKCSHSVAVIGAPFSKGQKRRGVEHGPAAIRSAGLIERL
SNLGCNVCDFGDLHFSKVPNDELYNSIVKHPRTVGLACKVLAEEVSKAVGAGHTCVTLGG
DHSLAFGSITGHAQQCPDLCVIWVDAHADINTPLTTPSGNLHGQPVSFLLRELQDKVPPI
PGFSWAKPCLSKSDIVYIGLRDLDPAEQFILKNYNISYYSMRHIDCMGIKKVMEKTFDQL
LGRRDRPIHLSFDIDAFDPALAPATGTPVIGGLTYREGVYITEEIHNTGMLSAVDLVEVN
PVLAATSEEVKATANLAVDVIASCFGQTREGAHTRADTIIDVLPTPSTSYESDNEEQVRI
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtcgataagaagcaatttcgtcaggctgctgaagaagcaagtcagtatcataaagctt
cagaagaaatgctctcactctgtggctgtgatcggggcgcccttctccaagggacagaaa
agaagaggtgtggagcatggccccgcagccattagaagtgctggtttaattgaaagactg
tccaatttaggatgcaatgtatgcgactttggagacttacacttttccaaggttcctaat
gatgaactgtacaacagcattgttaaacatcctcgtactgtaggacttgcctgcaaagtg
ctggctgaggaagtgagcaaagcagtgggagctgggcatacctgcgtaaccttgggtgga
gaccacagtttggcttttggatctatcactggccatgcccagcagtgcccggacctctgt
gtgatttgggtggatgcccatgcagatattaacacccctttgacaactccatcgggaaac
ctgcacggccagccagtgtcgttcctgctgagggaacttcaggataaggtaccaccaatc
cctggattttcttgggcaaagccatgtctatcaaagtctgatattgtatacattggcctg
agagacctggatccggctgaacaatttattctcaagaattataatatctcatattactca
atgagacacattgattgcatgggaataaagaaagtcatggagaaaactttcgatcagctc
ctgggcagaagagatcgcccaattcacttgagtttcgacattgatgcttttgacccagcc
ctagcgccagctacaggaactcctgtcattggaggactgacttacagggaaggtgtctat
atcacagaggaaattcataacacaggaatgttgtctgccgtggatcttgtagaagtaaat
ccagttcttgctgccacatcagaagaagttaaagccaccgcaaacctagcagtggacgtc
attgcttcttgttttggccagacgagagagggagctcacactagagctgacactattata
gatgtcctacctacacccagcacatcatatgaatcagacaatgaagagcaagtgagaatt
tag

DBGET integrated database retrieval system