KEGG   Xenopus laevis (African clawed frog): 379236Help
Entry
379236            CDS       T01010                                 

Gene name
gnai3.S, gnai3
Definition
(RefSeq) guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 S homeolog
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04261  Adrenergic signaling in cardiomyocytes
xla04371  Apelin signaling pathway
xla04540  Gap junction
xla04914  Progesterone-mediated oocyte maturation
xla04916  Melanogenesis
Module
xla_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    379236 (gnai3.S)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    379236 (gnai3.S)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    379236 (gnai3.S)
   04916 Melanogenesis
    379236 (gnai3.S)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    379236 (gnai3.S)
Exosome [BR:xla04147]
 Exosomal proteins
  Proteins found in most exosomes
   379236 (gnai3.S)
GTP-binding proteins [BR:xla04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    379236 (gnai3.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc AAA_29 AAA_16 TniB
Motif
Other DBs
NCBI-GeneID: 379236
NCBI-ProteinID: NP_001079549
Xenbase: XB-GENE-5738730
UniProt: Q7ZXT7
Position
2S
AA seq 354 aa AA seqDB search
MGCTLSAEDKEAAERSKMIDRNLREDGEKASKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYKVVVYSNTIQSIIAIIRAMGRLRIDFGDVARADDARQLFVLASSAEEGVMS
PELAGVIQRLWEDSGVQACFSRSREYQLNDSASYYLNDIERIAQGSYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLLLAEDEEM
NRMHESMKLFDSICNNKWFIDTSIILFLNKKDLFEEKISRSPLTICYPEYSGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKSNLMECGLY
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcacattgagtgccgaggataaggaggctgccgagcgaagtaaaatgatcgat
cggaaccttcgggaagatggggaaaaggcatccaaggaggtgaaactgctgctactcggt
gctggtgagtctgggaaaagcaccattgtgaagcaaatgaaaattatccatgaggatgga
tactccgaggaagaatgccggcagtacaaagtggtcgtatacagtaacactattcagtca
atcatcgctataatccgagccatgggaaggctaaggattgattttggagatgtggctaga
gctgatgatgctcgacagctctttgtgttggccagtagtgctgaggagggagttatgtct
ccagaacttgcaggtgtaattcagaggctgtgggaagattctggagttcaggcctgtttc
agccgttcccgtgaataccaacttaatgactctgcttcatactatctgaatgacattgaa
aggattgcccaaggcagctacattcctactcagcaggatgtacttcgaacgcgggtcaag
actacagggattgtggagacccatttcactttcaaggacctgtattttaaaatgtttgat
gtgggtggtcagaggtcagaaaggaagaaatggatccattgttttgagggagttactgca
atcattttttgtgtggcactcagtgattacgacttactgctggctgaagatgaggagatg
aatcggatgcatgaaagcatgaaattgtttgatagcatctgcaacaacaagtggttcata
gacacctcaatcatcctcttccttaacaaaaaggacctgtttgaagaaaagatctccagg
agcccccttactatttgctacccagaatactcagggtctaacacctatgaagaagctgca
gcctacattcagtgccagtttgaggacttgaaccggaggaaagacacaaaggaaatatac
acacatttcacatgtgccacggataccaagaacgttcagtttgtatttgatgcagtcaca
gatgtcataattaagagcaatctaatggagtgtggcctgtattag

DBGET integrated database retrieval system