KEGG   Xenopus laevis (African clawed frog): 379236Help
Entry
379236            CDS       T01010                                 

Gene name
gnai3
Definition
guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3
Orthology
K04630  
guanine nucleotide-binding protein G(i) subunit alpha
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Adrenergic signaling in cardiomyocytes
Tight junction
Gap junction
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    379236 (gnai3)
   04540 Gap junction
    379236 (gnai3)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    379236 (gnai3)
   04916 Melanogenesis
    379236 (gnai3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    379236 (gnai3)
Exosome [BR:xla04147]
 Exosomal proteins
  Proteins found in most exosomes
   379236 (gnai3)
GTP-binding proteins [BR:xla04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    379236 (gnai3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 354 aa AA seqDB search
MGCTLSAEDKEAAERSKMIDRNLREDGEKASKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYKVVVYSNTIQSIIAIIRAMGRLRIDFGDVARADDARQLFVLASSAEEGVMS
PELAGVIQRLWEDSGVQACFSRSREYQLNDSASYYLNDIERIAQGSYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLLLAEDEEM
NRMHESMKLFDSICNNKWFIDTSIILFLNKKDLFEEKISRSPLTICYPEYSGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKSNLMECGLY
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcacattgagtgccgaggataaggaggctgccgagcgaagtaaaatgatcgat
cggaaccttcgggaagatggggaaaaggcatccaaggaggtgaaactgctgctactcggt
gctggtgagtctgggaaaagcaccattgtgaagcaaatgaaaattatccatgaggatgga
tactccgaggaagaatgccggcagtacaaagtggtcgtatacagtaacactattcagtca
atcatcgctataatccgagccatgggaaggctaaggattgattttggagatgtggctaga
gctgatgatgctcgacagctctttgtgttggccagtagtgctgaggagggagttatgtct
ccagaacttgcaggtgtaattcagaggctgtgggaagattctggagttcaggcctgtttc
agccgttcccgtgaataccaacttaatgactctgcttcatactatctgaatgacattgaa
aggattgcccaaggcagctacattcctactcagcaggatgtacttcgaacgcgggtcaag
actacagggattgtggagacccatttcactttcaaggacctgtattttaaaatgtttgat
gtgggtggtcagaggtcagaaaggaagaaatggatccattgttttgagggagttactgca
atcattttttgtgtggcactcagtgattacgacttactgctggctgaagatgaggagatg
aatcggatgcatgaaagcatgaaattgtttgatagcatctgcaacaacaagtggttcata
gacacctcaatcatcctcttccttaacaaaaaggacctgtttgaagaaaagatctccagg
agcccccttactatttgctacccagaatactcagggtctaacacctatgaagaagctgca
gcctacattcagtgccagtttgaggacttgaaccggaggaaagacacaaaggaaatatac
acacatttcacatgtgccacggataccaagaacgttcagtttgtatttgatgcagtcaca
gatgtcataattaagagcaatctaatggagtgtggcctgtattag

DBGET integrated database retrieval system