KEGG   Xenopus laevis (African clawed frog): 379297Help
Entry
379297            CDS       T01010                                 

Gene name
cyp2c8.1, cpc8, cyp2c8, cypiic8, mp-12/mp-20
Definition
cytochrome P450, family 2, subfamily C, polypeptide 8, gene 1 (EC:1.14.14.1)
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:xla00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xla00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:xla00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:xla00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 496 aa AA seqDB search
MVMDSAGTILLSFCVILLLYVLVKWGGSSKHKHLPPGPTAFPLLGNFLQVGFTEVPASLV
RLSKTYGPVYTVHLGGHRSIILTGYDAVKEALIDHSDVFSDRGDGGVSQMLFKNYGVILS
HGERWKTMRRFTLTTLRNFGMGKRSIEERIQEEARSLEEAFLKKKDEPFDPMYLLGLAVS
NIICSIIFGERFDYEDGKFMTLLMYLREFFQLLNSFFGMLFNFFPNMFCYIPGPHQKLFM
YFNKLKEFVRDEAKSHKATLDANCPRDFIDCFLIKMEEEKINPNSEFHNENLSGTIIDLF
LAGTETTSLTLRYALLILLKYPEIQEKVYKEIDQVIGQGRCPSVEDRSKMPYTEAVIHEV
QRFADIIPLGLEHAASKDTIFRGYYIPKGTVIFPVLTSVLKDPKYFKNPDQFDPGHFLDE
NGLFKKNDAFLPFSSGKRMCAGEGLARMELFIFLTTILQKCILKSTVDTRDITITPEPNT
NASRPWPYKMYVVPRS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtaatggattctgctgggacgattcttctcagtttttgtgtcattctcctgctttat
gtattagtcaaatgggggggcagcagcaaacataaacatctgccccccggaccaacggca
tttccattgctgggcaattttttacaggtcggctttacagaagttcctgcgtcccttgtt
cggctaagtaaaacctatggacctgtgtacaccgtgcatctgggtggtcatcgatcaatc
atcctcactgggtacgatgctgtgaaggaagcattaattgaccacagtgatgtttttagt
gacagaggagatggaggggtttcacagatgctatttaaaaattatggtgttattctgagc
cacggagagaggtggaaaacaatgcggagatttactcttacgactctaagaaattttggg
atggggaagagaagcattgaagaaaggatacaagaggaagcccgaagcctggaagaagcc
tttctaaagaaaaaagatgaaccatttgatccaatgtacctgctgggactagctgtctcc
aatatcatctgttccattatttttggggagagatttgactatgaggatgggaaatttatg
actctacttatgtaccttagagagtttttccaattgctgaactctttctttggaatgctt
ttcaatttctttccaaacatgttttgctacattcctggcccccaccaaaagcttttcatg
tattttaataagctaaaagagtttgtgagggatgaggcaaaatctcacaaagctacgcta
gatgcaaactgtccaagagactttattgactgcttcctgataaaaatggaggaggaaaaa
attaatcctaacagtgaatttcacaatgagaatttgtctggaaccatcatcgatttgttt
ttagctgggacagagaccacaagtttgacactgagatatgccttacttattttactcaag
tacccagaaattcaagaaaaggtctataaggagattgatcaagtgataggtcaaggccgc
tgcccatcagtcgaggacaggagcaagatgccatatactgaagctgtaatccatgaggtt
caacgatttgcagacattattccacttggattggaacatgcagccagcaaagacacaatc
tttagaggatattacattcccaagggaactgtgatatttccagtactaacctctgtgctt
aaggatcctaaatacttcaaaaatccagatcagtttgaccctgggcactttctagatgag
aatggcctctttaagaaaaatgatgcttttctcccattttcctcagggaaacgtatgtgc
gcaggggaaggactggctcggatggagctcttcatatttcttactaccattttacagaaa
tgtattttaaaatccactgtggatacaagagatattacaattaccccagaacccaacacc
aatgcttcacgaccgtggccctacaagatgtatgtcgtccctcgtagctga

DBGET integrated database retrieval system