KEGG   Xenopus laevis (African clawed frog): 379402Help
Entry
379402            CDS       T01010                                 

Gene name
MGC53924
Definition
Catechol O-methyltransferase-like
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    379402 (MGC53924)
  Amino acid metabolism
   00350 Tyrosine metabolism
    379402 (MGC53924)
Enzymes [BR:xla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     379402 (MGC53924)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   379402 (MGC53924)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 261 aa AA seqDB search
MVDVPTVVLSSAGTLCVATLLFTLYNWRRAHIKMALSLSYQAIKNILLCKSKEQRILDFV
LKNAISGDPKSVIDNVDKYCSQKEWSMNVGDEKGVILDNIVKETNPSTLLELGTYCGYSA
IRICRSLKPGARFFTVEFNPAYAAVAKQMIEFAGLKDKVQVLEGSTSDIIPQLKKKYEVE
TLDFVFVDHWKDKYKPDTQLLEKCNLLRKGSVVLADNVIVPGAPDFLEYVRNCGKYDCTN
FPSFLEYMDEKDALEKAVFRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggtggatgtgccgacagttgtgttatcctctgcggggacactctgtgttgcaaccttg
ttgttcacactttataattggaggcgtgcccatattaaaatggcattgagtctaagctat
caagccatcaaaaacattttgttatgcaagtctaaggaacagagaattttggactttgtg
ctgaagaacgccatctctggggacccaaagagtgtaatagataatgttgacaaatactgc
agtcaaaaggagtggtctatgaacgtgggagatgaaaaaggtgttatcttggataacata
gtaaaggagacaaacccatctacattgctggagctgggaacatactgtggatattctgct
attcggatctgccgctcactgaagcctggcgctcgcttcttcacggtggaattcaaccca
gcctatgccgcggtggccaagcagatgattgaatttgctgggcttaaggacaaggtgcaa
gtacttgaaggttccacaagtgacattatcccccaattgaagaaaaaatatgaagtggaa
actctggattttgtctttgtagatcattggaaggataaatacaagccagatactcaactt
ttggaaaaatgcaacttgctgagaaagggctcggttgtacttgctgacaacgtgattgtg
ccaggagctccagatttcctagaatatgtccggaactgtggcaaatacgactgtaccaat
tttccatctttcttggaatatatggatgaaaaagatgcgcttgaaaaggctgtttttaga
ggataa

DBGET integrated database retrieval system