KEGG   Xenopus laevis (African clawed frog): 379460Help
Entry
379460            CDS       T01010                                 

Gene name
MGC64344
Definition
Trypsin (EC:3.4.21.4)
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    379460 (MGC64344)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     379460 (MGC64344)
Peptidases [BR:xla01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   379460 (MGC64344)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   379460 (MGC64344)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 243 aa AA seqDB search
MKFLLLCVLLGAAAAFDDDKIIGGATCAKSSVPYIVSLNSGYHFCGGSLITNQWVVSAAH
CYKASIQVRLGEHNIALSEGTEQFISSSKVIRHSGYNSYTLDNDIMLIKLSSPASLNAAV
NTVPLPSGCSAAGTSCLISGWGNTLSNGSNYPDLLQCLNAPILTNAQCNSAYPGEITANM
ICVGFMEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAMRNYPGVYTKVCNYNAWIQNTI
AAN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttcttttgctctgtgtcctgctgggagcggctgctgcctttgatgatgataag
atcatagggggtgccacctgcgccaagagctctgtcccctacatcgtctccctgaactct
gggtaccatttctgtggggggtccctgatcactaaccagtgggtcgtgtctgccgctcac
tgctacaaagcgagcattcaggttagactgggggaacacaacatcgctctgagtgaggga
accgagcagtttatcagctcctcaaaggtcattagacattctggctacaactcttatacc
ttggacaatgacattatgctgatcaagctctcctctcctgcctccctcaatgccgctgtc
aataccgtgccactgccctccggttgttctgccgctggtaccagctgcttgatctctggc
tggggcaacactctcagcaatggcagcaattatcctgacctcctgcagtgcctgaatgcc
cccatcctgactaatgcccagtgtaacagtgcctacccaggggagatcaccgctaacatg
atctgtgttggcttcatggaaggtggcaaggattcctgccagggtgactccggtggcccc
gtggtgtgcaatgggcaactgcaaggtgtggtgtcctggggctatggctgtgccatgagg
aactatcctggtgtctacaccaaggtctgcaactacaacgcctggatccaaaacaccatt
gctgccaactaa

DBGET integrated database retrieval system