KEGG   Xenopus laevis (African clawed frog): 379479Help
Entry
379479            CDS       T01010                                 

Gene name
cyp2d6-b
Definition
cytochrome P450, family 2, subfamily D, polypeptide 6 (EC:1.14.14.1)
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Steroid hormone biosynthesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:xla00140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 505 aa AA seqDB search
MSLLSQLCPFAFGCNVFTLGIICTLCLLLLDYMKRRKPCTNFPPSPPSRPFVGNLLQVDL
KNLHNSIKQLSKQYGDVISLQLFWKPMVVLNGFEVMKEALIQKSEDIADRPTIYIFDIFG
FGANNRGVMFANYGQSWKDLRRFTLSTLRDFGMGKKSLEERVGEEAGYLCAAFQSEQGRP
FYPNVLLNTAVSNIICSIIFGERFEYDDHKFQKLLSLTEEILISGSETMPQVLCLLPWSA
KFPSLAKRFFKPRISMEKYLKEIINEHQQTWDSGHTRDFIDAFILEMEKEKAVKDSNFNE
ENLQLTIADLFSAGTETTSSTLRWGLLFMLLYPDVQRKVNAEIDQVIGRTRKPTMGDVSQ
MPYTNAVIHEIQRYADIIPLSVPHVTYRDTYIKGFFIPKGILIMTNLSSVLKDERVWEKP
FQFYPEHFLDRDGKFVKREAFMAFSAGRRVCLGEQLARMTLFLFFTSLLQHFSFQIPDGE
PSPREDPVIVYNQIPHDYKICAKVR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagccttttgtcacagctctgcccatttgcctttgggtgtaatgtcttcacactgggc
atcatctgtaccctttgccttctgctgctggattacatgaagcgcagaaaaccctgcaca
aatttccctcccagccctccctccaggccctttgtgggaaatctgctgcaggtggactta
aaaaatcttcacaacagcatcaaacagctctctaaacagtatggggatgtgataagcctg
cagctcttttggaaacccatggtggtgctcaatggatttgaagtcatgaaggaggccttg
atacagaagtcagaggacatagcagatcgtcccacaatttacatatttgatatctttggg
tttggtgcaaacaacagaggtgttatgtttgcaaattatggccaatcttggaaggaccta
agaagatttactttgtctacgttgagggattttggcatggggaaaaaatccctggaggag
agagtaggagaagaagctgggtacctgtgtgctgcgttccagtctgagcaaggtcgtcct
ttttacccaaatgttttgctgaacacagcagttagtaacattatctgctctatcatattt
ggtgaacggtttgaatatgatgatcacaagttccaaaagctgttgagtctaactgaagag
attttaatatctggatccgagacaatgccccaggttttatgtttacttccttggtcagct
aaatttcccagcctagccaagcggtttttcaaacctcggatatctatggaaaaatatcta
aaagaaattatcaatgagcatcagcaaacatgggattctgggcacacaagagattttatt
gatgcctttatacttgagatggaaaaggaaaaagcagttaaagacagcaattttaatgag
gagaatcttcagttaaccatagctgacttattttcagctggcacagaaaccacatcctca
accctgagatggggccttctgtttatgctactgtacccagatgtgcaaagaaaggtgaat
gcggaaattgaccaagtgattggaagaaccaggaagccgactatgggagatgtgtcacag
atgccttataccaatgccgtaatccatgaaatccagcgttacgcagatataatccctctc
tctgtgccacatgtgacatacagagacacatatatcaaaggcttcttcatcccaaaaggc
atccttattatgaccaatctgtcatctgtgcttaaagatgagagagtctgggaaaagcct
tttcagttttatccggaacattttcttgatagggatggcaagtttgtgaaaagagaagca
tttatggcattctctgcaggtcgccgtgtttgtctaggagagcagctggccaggatgact
ctgttcctcttcttcacgtctctcctgcagcacttctcatttcagattcctgatggcgag
ccgagcccacgggaagatcctgtaattgtatacaatcagatcccacatgattataaaatc
tgtgccaaggttagatag

DBGET integrated database retrieval system