KEGG   Xenopus laevis (African clawed frog): 379495Help
Entry
379495            CDS       T01010                                 

Gene name
ctrl
Definition
chymotrypsin-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     379495 (ctrl)
Peptidases [BR:xla01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   379495 (ctrl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 263 aa AA seqDB search
MALLWLLSCIALIGSTYGCGSPAINPILSGYARIVNGENAVPGSWPWQISLQDSTGFHFC
GGSLISDLWVVTAAHCGVTTSHRVILGEYDRSSPAEPIQTKTIAKVFRHPSYNSFTIAND
ITLLKLSSPASFSNTVSTVCVAASVDAFNSGERCVTTGWGYVDAASRLTPNKLQQVALPL
LSNTECRRYWGSKILSTMVCAGASGASSCMGDSGGPLVCQRNGAWVLAGIVSWGSSTCSP
SSPGVYARVSTLRSWMDQIIAAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcacttctctggcttttgtcctgcattgcccttattgggagcacgtatggctgtggt
agcccagccatcaatccaatactttctggatatgctaggattgtgaatggtgaaaatgca
gtacctggatcctggccttggcaaatttctctgcaggacagcactggtttccacttctgt
ggtggctctttgattagcgacctctgggttgtcactgctgcacattgcggtgtcacaacc
tcccaccgtgttattcttggtgaatatgatcgttcttctccagctgagcctatccagacc
aaaacaattgccaaggttttcagacaccccagttacaactcgttcaccattgccaatgat
atcacacttctgaaactgtccagccctgcttccttcagcaacactgtttctactgtctgc
gttgctgcttccgtagatgcgttcaatagtggcgagagatgcgtcacaactggctggggc
tacgtggatgctgcctctagattaaccccaaacaagctgcagcaggtagctctgcctctt
ctaagcaacactgaatgccggagatattggggaagcaagatcctaagcacaatggtctgt
gctggtgcttctggtgcctcttcttgcatgggtgactctggtggaccacttgtgtgccaa
agaaatggagcttgggtgctggctggaattgtgtcctggggaagttctacatgctctcca
tcatctcctggagtatatgctcgtgtctcaactcttagatcctggatggatcagataatt
gctgccaattaa

DBGET integrated database retrieval system