KEGG   Xenopus laevis (African clawed frog): 379505Help
Entry
379505            CDS       T01010                                 

Definition
uncharacterized protein MGC64309
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:xla04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 505 aa AA seqDB search
MMRARFVFCCTLLVVARADILEEQDVLVLKKDNFDEALKQNQFILVEFYAPWCGHCKALA
PEYEKAAGILKSEGLSIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKSSPKEYSAGR
EAADIVNWLKKRTGPAASVLSDEAAVAALVDSSEVAVIGFFKDPESELAKVFLKAAEAVD
DIPFGITSSDAAFSKHELSKDGIVVFKKFDEGRNTFEGENTKEELLSFIKANRLPLVIEF
TEQTAPMIFGGEIKTHILFFLPKSAMDYKDKLENFKKAAESFKGKILFIFIDSDHIDNQR
ILEFFGLKKEECPTVRLITLEEEMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDV
PEDWDKNPVKVLVGKNFEEVAFDEEKNVLVEFYAPWCGHCKQLAPIWDQLGEKYKNHDSI
IIAKMDSTVNEIEAVKIHSFPTLKFFPAGPGKVADYNGERTLEGFSKFLESGGQDGAADE
DLEDLEDADETDLEEGDEVHTKDEL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtgctagatttgttttctgctgtactctattggtcgtcgccagggccgatatt
ctggaggagcaggacgtgctggtgctcaagaaagacaactttgatgaggcgctcaaacag
aatcagtttatcctagtggagttctatgctccctggtgtggccactgcaaggcacttgct
ccagaatatgagaaggctgctggcatattaaaaagtgaaggtttatcaatacgcttgggc
aaggtagatgcaacagaagagtctgatctggctcaggagtttggcgttcgaggttaccca
acaatcaaattcttcaaaaatggagacaagtcttctcctaaagaatattcagctggcagg
gaggcagcagatattgtcaactggctgaagaagcgtactggtccagctgccagtgttctg
agtgatgaggcagctgttgcagctttggtggattccagtgaggttgccgttattggtttc
tttaaggatccagagtcggagctagctaaagtgtttctgaaagcagctgaggcagtagat
gatattccatttggcatcacatccagcgatgcagccttctcaaaacacgaactcagcaag
gatggcattgttgtgtttaagaagtttgatgaaggccgaaatacatttgagggagagaac
acaaaggaagaacttttgagcttcataaaggccaatcggttgcctctcgttatagaattt
actgagcagactgctccaatgatctttggtggagagattaagactcatattctcttcttt
ttgccgaaaagtgctatggattacaaagacaaattagagaattttaagaaggcagccgaa
agcttcaaaggaaagattcttttcatctttattgatagtgatcacattgacaaccagcgt
attctggagttctttggcttaaagaaggaagaatgcccaactgtacggcttattactttg
gaggaagaaatgacaaaatacaagccagagagtgctgatctttcagctgaggccattaaa
gagttctgtgacagtttcctagagggaaaagtcaagccacacttaatgagccaggatgtt
ccagaagactgggacaaaaaccctgtgaaagtattggtggggaagaactttgaggaagtg
gcctttgatgaggagaagaatgtacttgtagaattctatgctccatggtgtggccactgc
aagcaactggcaccaatctgggaccagttgggggagaagtataagaaccacgatagcatc
attattgccaagatggattctacagttaatgagatagaagctgttaagattcacagcttc
cctacactgaagtttttccctgctggaccaggaaaggtggctgattataatggcgaaagg
accctagaaggcttttcaaagtttttggagagtggggggcaggatggagctgctgatgag
gatcttgaagatttagaagatgctgatgaaactgatttggaggagggagatgaagtacat
acaaaagatgaattataa

DBGET integrated database retrieval system