KEGG   Xenopus laevis (African clawed frog): 379505Help
Entry
379505            CDS       T01010                                 

Definition
uncharacterized protein MGC64309
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    379505
Enzymes [BR:xla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     379505
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   379505
  Exosomal proteins of colorectal cancer cells
   379505
  Exosomal proteins of bladder cancer cells
   379505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 505 aa AA seqDB search
MMRARFVFCCTLLVVARADILEEQDVLVLKKDNFDEALKQNQFILVEFYAPWCGHCKALA
PEYEKAAGILKSEGLSIRLGKVDATEESDLAQEFGVRGYPTIKFFKNGDKSSPKEYSAGR
EAADIVNWLKKRTGPAASVLSDEAAVAALVDSSEVAVIGFFKDPESELAKVFLKAAEAVD
DIPFGITSSDAAFSKHELSKDGIVVFKKFDEGRNTFEGENTKEELLSFIKANRLPLVIEF
TEQTAPMIFGGEIKTHILFFLPKSAMDYKDKLENFKKAAESFKGKILFIFIDSDHIDNQR
ILEFFGLKKEECPTVRLITLEEEMTKYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDV
PEDWDKNPVKVLVGKNFEEVAFDEEKNVLVEFYAPWCGHCKQLAPIWDQLGEKYKNHDSI
IIAKMDSTVNEIEAVKIHSFPTLKFFPAGPGKVADYNGERTLEGFSKFLESGGQDGAADE
DLEDLEDADETDLEEGDEVHTKDEL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtgctagatttgttttctgctgtactctattggtcgtcgccagggccgatatt
ctggaggagcaggacgtgctggtgctcaagaaagacaactttgatgaggcgctcaaacag
aatcagtttatcctagtggagttctatgctccctggtgtggccactgcaaggcacttgct
ccagaatatgagaaggctgctggcatattaaaaagtgaaggtttatcaatacgcttgggc
aaggtagatgcaacagaagagtctgatctggctcaggagtttggcgttcgaggttaccca
acaatcaaattcttcaaaaatggagacaagtcttctcctaaagaatattcagctggcagg
gaggcagcagatattgtcaactggctgaagaagcgtactggtccagctgccagtgttctg
agtgatgaggcagctgttgcagctttggtggattccagtgaggttgccgttattggtttc
tttaaggatccagagtcggagctagctaaagtgtttctgaaagcagctgaggcagtagat
gatattccatttggcatcacatccagcgatgcagccttctcaaaacacgaactcagcaag
gatggcattgttgtgtttaagaagtttgatgaaggccgaaatacatttgagggagagaac
acaaaggaagaacttttgagcttcataaaggccaatcggttgcctctcgttatagaattt
actgagcagactgctccaatgatctttggtggagagattaagactcatattctcttcttt
ttgccgaaaagtgctatggattacaaagacaaattagagaattttaagaaggcagccgaa
agcttcaaaggaaagattcttttcatctttattgatagtgatcacattgacaaccagcgt
attctggagttctttggcttaaagaaggaagaatgcccaactgtacggcttattactttg
gaggaagaaatgacaaaatacaagccagagagtgctgatctttcagctgaggccattaaa
gagttctgtgacagtttcctagagggaaaagtcaagccacacttaatgagccaggatgtt
ccagaagactgggacaaaaaccctgtgaaagtattggtggggaagaactttgaggaagtg
gcctttgatgaggagaagaatgtacttgtagaattctatgctccatggtgtggccactgc
aagcaactggcaccaatctgggaccagttgggggagaagtataagaaccacgatagcatc
attattgccaagatggattctacagttaatgagatagaagctgttaagattcacagcttc
cctacactgaagtttttccctgctggaccaggaaaggtggctgattataatggcgaaagg
accctagaaggcttttcaaagtttttggagagtggggggcaggatggagctgctgatgag
gatcttgaagatttagaagatgctgatgaaactgatttggaggagggagatgaagtacat
acaaaagatgaattataa

DBGET integrated database retrieval system