KEGG   Xenopus laevis (African clawed frog): 379614Help
Entry
379614            CDS       T01010                                 

Gene name
cpa1.S, carbA, cpa
Definition
(RefSeq) carboxypeptidase A1 S homeolog
  KO
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     379614 (cpa1.S)
Peptidases [BR:xla01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   379614 (cpa1.S)
Chaperones and folding catalysts [BR:xla03110]
 Intramolecular chaperones
  Other peptidases
   379614 (cpa1.S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
3S
AA seq 416 aa AA seqDB search
MNSFCVLGLYINALLLHRQQVLRIFPTDEDQVNLVRALEDLEHLQIDFWTSPSRVLLPID
IRVPFRNLQSVKVYLESNNIQYSIMIHDIQSLLNEEQNDMRRNRATENTRSTDSFNYAAY
HTFDEINAFIDNLVRENPNLVSKIQIGSSYEGRPLNVLKFSTGPNRPAFWIDTGIHSREW
VTQASGVWFAKKIVTDYGKDASLTNTLNKIDILLEIVTNPDGFVYTHTSNRMWRKTRSPN
SGSRCIGTDPNRNWDAGFGGPGSSSNACTETYRGRAAHSEPEVKAIVDFVKSHGNIKGFV
SIHSYSQMLLFPYGYTSARAPNHDELNAVSRDAVNALASLYGTAYTYGSIITTIYQASGG
TIDWTYDQGIKHSYTFELRDTGRYGFALPANQIIPTAEETWLALTKLIEHTRDNPY
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaactcattttgtgtcttgggcttgtacatcaatgccttattattacacagacaacaa
gtcctccgaattttccctactgatgaggatcaggtgaacctggtgagggcgttggaagat
ctggaacatttacagatcgatttttggacaagtccctcaagagtccttttgcccattgat
atccgagttccattccgcaatctgcaatcagtgaaagtctacctggaatccaacaatatc
cagtacagcattatgattcacgacatccagagtttgctgaatgaagagcaaaacgatatg
agacgtaatcgtgccactgaaaacacaaggtctactgacagcttcaattatgctgcctat
catacatttgatgagatcaacgcctttatcgacaatttggttagagaaaatccaaatttg
gtcagcaaaatacagattggctcaagttatgaaggccgtcctcttaatgttctgaagttc
agcacaggtcccaaccgcccggcattctggattgacactggtatccattcccgtgagtgg
gtcacacaagctagtggtgtttggtttgccaaaaagattgtaacagattatgggaaagat
gcatccttgacaaatacactcaacaaaattgatatcctcttggaaattgtgaccaaccct
gatggctttgtttacactcatacatcgaatcgtatgtggcgcaaaaccagatctccaaat
tctggttcccgctgtattggaactgaccccaacagaaactgggatgcaggctttggaggt
cctggctcaagctcaaatgcctgcactgaaacctacagaggacgcgctgcccattctgaa
cctgaagtgaaagccattgtggactttgtgaaaagtcacggcaacatcaaaggctttgtc
tccattcacagctactcccagatgcttctctttccatatggatatactagtgccagagcc
cccaaccacgatgagctaaacgctgtgtcaagggatgctgttaatgccttggcctcactg
tatggaacagcttacacctatggcagcataattactacgatctatcaagcaagtggagga
accattgactggacctacgatcagggaattaagcactcctacacctttgagctgcgtgac
acaggccgctatggatttgcactaccagctaaccaaatcattccaactgcagaggagact
tggcttgcactcaccaagctgattgagcacacccgtgataatccttattaa

DBGET integrated database retrieval system