KEGG   Xenopus laevis (African clawed frog): 379614Help
Entry
379614            CDS       T01010                                 

Definition
uncharacterized protein MGC64526
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 416 aa AA seqDB search
MNSFCVLGLYINALLLHRQQVLRIFPTDEDQVNLVRALEDLEHLQIDFWTSPSRVLLPID
IRVPFRNLQSVKVYLESNNIQYSIMIHDIQSLLNEEQNDMRRNRATENTRSTDSFNYAAY
HTFDEINAFIDNLVRENPNLVSKIQIGSSYEGRPLNVLKFSTGPNRPAFWIDTGIHSREW
VTQASGVWFAKKIVTDYGKDASLTNTLNKIDILLEIVTNPDGFVYTHTSNRMWRKTRSPN
SGSRCIGTDPNRNWDAGFGGPGSSSNACTETYRGRAAHSEPEVKAIVDFVKSHGNIKGFV
SIHSYSQMLLFPYGYTSARAPNHDELNAVSRDAVNALASLYGTAYTYGSIITTIYQASGG
TIDWTYDQGIKHSYTFELRDTGRYGFALPANQIIPTAEETWLALTKLIEHTRDNPY
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaactcattttgtgtcttgggcttgtacatcaatgccttattattacacagacaacaa
gtcctccgaattttccctactgatgaggatcaggtgaacctggtgagggcgttggaagat
ctggaacatttacagatcgatttttggacaagtccctcaagagtccttttgcccattgat
atccgagttccattccgcaatctgcaatcagtgaaagtctacctggaatccaacaatatc
cagtacagcattatgattcacgacatccagagtttgctgaatgaagagcaaaacgatatg
agacgtaatcgtgccactgaaaacacaaggtctactgacagcttcaattatgctgcctat
catacatttgatgagatcaacgcctttatcgacaatttggttagagaaaatccaaatttg
gtcagcaaaatacagattggctcaagttatgaaggccgtcctcttaatgttctgaagttc
agcacaggtcccaaccgcccggcattctggattgacactggtatccattcccgtgagtgg
gtcacacaagctagtggtgtttggtttgccaaaaagattgtaacagattatgggaaagat
gcatccttgacaaatacactcaacaaaattgatatcctcttggaaattgtgaccaaccct
gatggctttgtttacactcatacatcgaatcgtatgtggcgcaaaaccagatctccaaat
tctggttcccgctgtattggaactgaccccaacagaaactgggatgcaggctttggaggt
cctggctcaagctcaaatgcctgcactgaaacctacagaggacgcgctgcccattctgaa
cctgaagtgaaagccattgtggactttgtgaaaagtcacggcaacatcaaaggctttgtc
tccattcacagctactcccagatgcttctctttccatatggatatactagtgccagagcc
cccaaccacgatgagctaaacgctgtgtcaagggatgctgttaatgccttggcctcactg
tatggaacagcttacacctatggcagcataattactacgatctatcaagcaagtggagga
accattgactggacctacgatcagggaattaagcactcctacacctttgagctgcgtgac
acaggccgctatggatttgcactaccagctaaccaaatcattccaactgcagaggagact
tggcttgcactcaccaagctgattgagcacacccgtgataatccttattaa

DBGET integrated database retrieval system