KEGG   Xenopus laevis (African clawed frog): 379626Help
Entry
379626            CDS       T01010                                 

Gene name
pkmyt1, myt1
Definition
protein kinase, membrane associated tyrosine/threonine 1 (EC:2.7.11.1)
Orthology
K06633  
membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:xla04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xla04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xla04914]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 548 aa AA seqDB search
MPVPGDDMGETPLTRTPIPMPAYFSQAEQSFSLKKRGRSLCYTLPPRPPVKSALPVSRIF
PNKQRSWSQPRPQSVSFRSPQNKTPASKLYDQSKGDTFFKQCFKSICKLGRGSFGEVYKV
QSLEDGCFYAVKRSVSPFRGESDRQRKLQEVRKHERVGEHPNCLRFVRAWEEKRMLYLQT
ELCAGSLQQHSEEFAGSLPPRRVWNITCDLLHGLKHLHDRNLLHLDIKPANVFISFSGVC
KLGDFGLMVELDGTEGSGEAQEGDPRYMAPELLDGIFSKAADVFSLGMSLLEVACNMELP
KGGDGWQQLRQGHLPTEFTSDLPPDFLKVLSAMLEPDYRRRATVDWLLSLPAIRNAERWR
MVTLAQERTLGKIIAVYQFIVWLLSFVFQWLNRPVIGFLHYCGLRALPRSPPCSPFPNHL
GESSFSSDWDDESLGDDVFEVPPSPLATHRNLTYHGQELIGRHSPDLLSRPSLGSTSTPR
NLSPEFSMRKRSALPLTPNVSRISQDSTGKSRSPSTSHSSSGFVDAEVQRTLFLPRNLLG
MFDDATEQ
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttccaggggatgacatgggagagactcccctgactcgcactccaatccctatg
cctgcttactttagccaggcagagcaaagcttttcacttaagaaaagagggcgctctctt
tgctataccctcccacccagacctccagttaaaagcgctctacctgtaagccgtatcttc
ccaaataaacagcgatcttggagccagcccagaccacagagcgtttcttttcgaagtccc
caaaataaaacccctgcaagcaagctttatgaccagagcaaaggagatacatttttcaag
cagtgttttaaaagcatttgcaaattaggaagaggatcctttggggaggtatacaaggtg
caaagccttgaggatggatgcttctatgctgtaaagcgttctgtatctccgttccgcggt
gagtcagaccggcaacggaagcttcaggaggtgaggaagcatgagcgagttggggagcac
cccaattgcctacgttttgtgcgagcatgggaagagaaacgaatgctctaccttcagaca
gagttatgtgcagggagtttgcaacagcattctgaagaatttgctgggtctcttcctcca
cgtcgagtatggaacataacttgtgacctgctgcatggtctcaaacatcttcatgatcgc
aaccttctgcaccttgacattaagccagctaatgtcttcatttctttttctggtgtttgc
aaacttggtgatttcggactcatggtagaattggatgggactgaaggaagtggggaagca
caggaaggtgaccctcgctatatggcacctgaactgttggatggtatcttttcgaaggct
gctgatgtgttcagtcttggaatgagtcttctagaagtcgcttgcaatatggagcttccg
aaaggtggagatggttggcaacagctgagacaagggcatctccctacagagtttacatca
gacctgccaccagacttcctaaaagttctttctgcaatgctggagcctgattaccgccgc
cgtgccacagtagactggctactctcccttcctgctatccgtaatgcagagagatggagg
atggtgacactagcgcaggaaaggacacttggcaagataatagcagtctatcagttcata
gtttggcttctatctttcgtgtttcaatggctaaatcgtcctgttataggatttttacat
tactgtggattgagggctcttccaaggtcacctccctgttctccttttcctaaccatctt
ggggagagcagcttctctagtgactgggatgatgagagtcttggtgatgatgtgtttgag
gtaccgccaagcccactggccactcaccgaaatctgacataccatgggcaggagctcatt
ggcagacattctccagatctactctcaaggccgtcacttggaagtacctctacccctcgc
aatttgtctcctgaattcagcatgagaaagaggtctgccctgcctctaacgcctaatgtc
agtcggattagccaggattctacaggcaagtctagaagcccctccaccagtcatagctcc
tctggatttgtggatgctgaagtccagcgtaccttatttcttcctcgcaatctgctcggt
atgtttgacgatgccaccgagcaatga

DBGET integrated database retrieval system