KEGG   Xenopus laevis (African clawed frog): 379626Help
Entry
379626            CDS       T01010                                 

Gene name
pkmyt1, myt1
Definition
protein kinase, membrane associated tyrosine/threonine 1 (EC:2.7.11.1)
Orthology
K06633  
membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xla00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    379626 (pkmyt1)
   04114 Oocyte meiosis
    379626 (pkmyt1)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    379626 (pkmyt1)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     379626 (pkmyt1)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: Other group
  WEE family
   379626 (pkmyt1)
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     379626 (pkmyt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 548 aa AA seqDB search
MPVPGDDMGETPLTRTPIPMPAYFSQAEQSFSLKKRGRSLCYTLPPRPPVKSALPVSRIF
PNKQRSWSQPRPQSVSFRSPQNKTPASKLYDQSKGDTFFKQCFKSICKLGRGSFGEVYKV
QSLEDGCFYAVKRSVSPFRGESDRQRKLQEVRKHERVGEHPNCLRFVRAWEEKRMLYLQT
ELCAGSLQQHSEEFAGSLPPRRVWNITCDLLHGLKHLHDRNLLHLDIKPANVFISFSGVC
KLGDFGLMVELDGTEGSGEAQEGDPRYMAPELLDGIFSKAADVFSLGMSLLEVACNMELP
KGGDGWQQLRQGHLPTEFTSDLPPDFLKVLSAMLEPDYRRRATVDWLLSLPAIRNAERWR
MVTLAQERTLGKIIAVYQFIVWLLSFVFQWLNRPVIGFLHYCGLRALPRSPPCSPFPNHL
GESSFSSDWDDESLGDDVFEVPPSPLATHRNLTYHGQELIGRHSPDLLSRPSLGSTSTPR
NLSPEFSMRKRSALPLTPNVSRISQDSTGKSRSPSTSHSSSGFVDAEVQRTLFLPRNLLG
MFDDATEQ
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttccaggggatgacatgggagagactcccctgactcgcactccaatccctatg
cctgcttactttagccaggcagagcaaagcttttcacttaagaaaagagggcgctctctt
tgctataccctcccacccagacctccagttaaaagcgctctacctgtaagccgtatcttc
ccaaataaacagcgatcttggagccagcccagaccacagagcgtttcttttcgaagtccc
caaaataaaacccctgcaagcaagctttatgaccagagcaaaggagatacatttttcaag
cagtgttttaaaagcatttgcaaattaggaagaggatcctttggggaggtatacaaggtg
caaagccttgaggatggatgcttctatgctgtaaagcgttctgtatctccgttccgcggt
gagtcagaccggcaacggaagcttcaggaggtgaggaagcatgagcgagttggggagcac
cccaattgcctacgttttgtgcgagcatgggaagagaaacgaatgctctaccttcagaca
gagttatgtgcagggagtttgcaacagcattctgaagaatttgctgggtctcttcctcca
cgtcgagtatggaacataacttgtgacctgctgcatggtctcaaacatcttcatgatcgc
aaccttctgcaccttgacattaagccagctaatgtcttcatttctttttctggtgtttgc
aaacttggtgatttcggactcatggtagaattggatgggactgaaggaagtggggaagca
caggaaggtgaccctcgctatatggcacctgaactgttggatggtatcttttcgaaggct
gctgatgtgttcagtcttggaatgagtcttctagaagtcgcttgcaatatggagcttccg
aaaggtggagatggttggcaacagctgagacaagggcatctccctacagagtttacatca
gacctgccaccagacttcctaaaagttctttctgcaatgctggagcctgattaccgccgc
cgtgccacagtagactggctactctcccttcctgctatccgtaatgcagagagatggagg
atggtgacactagcgcaggaaaggacacttggcaagataatagcagtctatcagttcata
gtttggcttctatctttcgtgtttcaatggctaaatcgtcctgttataggatttttacat
tactgtggattgagggctcttccaaggtcacctccctgttctccttttcctaaccatctt
ggggagagcagcttctctagtgactgggatgatgagagtcttggtgatgatgtgtttgag
gtaccgccaagcccactggccactcaccgaaatctgacataccatgggcaggagctcatt
ggcagacattctccagatctactctcaaggccgtcacttggaagtacctctacccctcgc
aatttgtctcctgaattcagcatgagaaagaggtctgccctgcctctaacgcctaatgtc
agtcggattagccaggattctacaggcaagtctagaagcccctccaccagtcatagctcc
tctggatttgtggatgctgaagtccagcgtaccttatttcttcctcgcaatctgctcggt
atgtttgacgatgccaccgagcaatga

DBGET integrated database retrieval system