KEGG   Xenopus laevis (African clawed frog): 379632Help
Entry
379632            CDS       T01010                                 

Definition
uncharacterized protein MGC68847
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    379632
   01230 Biosynthesis of amino acids
    379632
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    379632
   00030 Pentose phosphate pathway
    379632
   00051 Fructose and mannose metabolism
    379632
   00052 Galactose metabolism
    379632
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    379632
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     379632
Protein phosphatases and associated proteins [BR:xla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     379632
Messenger RNA biogenesis [BR:xla03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     379632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 784 aa AA seqDB search
MAQPDKKLFENLSGKGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVQAKVYFIYEGYQGMV
DGGDNIEEVSWESVSSILQVGGTVIGSARCKSFRNREGRLQAACNLVQRGITNLCVIGGD
GSLTGANLFREEWSGLLDELVQTGKIEAEAAKEYAHLNIVGMVGSIDNDFCGTDMTIGTD
SALHRIMEVVDAIMTTALSHQRTFVLEVMGRHCGYLALVSALACGADWMFIPESPPEEGW
EDLMCNKLSENRARKKRLNIIIVSEGAIDCHNKPITSDLVKDLVVKRLGFDTRVTILGHV
QRGGTPSAFDRILASRMGVDCVLALLEATPETPACVVSLCGNQAVRLPLMECVQMTQEVQ
KAMDERRFEDAVRLRGRSFENNLNTYKLLSHKKNISELPKSNFNVAVLNVGAPAAGMNAA
VRSAVRVGITEGHKMFAVNDGFEGFAKGQIKEIKWGGVGGWTGQGGSLLGTKRTLPAKYF
DQIAEQIRTNKIHALLVIGGFEAFLGLLEMVEGRGKYDEFCIPMVMVPATVSNNVPGSDF
SIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEE
SFDIRELQANVEHLTEKMKTSIQRGLILRNENSNENYTTDFIYQLYSEEGRGVFDCRKNV
LGHMQQGGAPSPFDRNFGTKISAKAVQWISKKLKETYRNGRVFANTDDSVCLLGMRRRNL
LFQPVTQLKDETDFKHRIPREQWWLKMRPLMKILAKYKTSYDISDAGKLEHVNMCRRKDE
TGAI
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggcacagccagataagaagcttttcgagaatctgtccgggaagggcaaagccatcggg
gtactgacaagcggaggagatgcccaaggtatgaacgcagctgtgcgcgctgtagtgcga
atgggcatctacgtacaagccaaagtgtacttcatttatgagggataccaaggaatggtg
gacggaggagacaatattgaggaagtgtcgtgggaaagcgtttctagcatcttgcaagtg
ggtgggaccgtcatcggcagtgcacgttgcaagtcattccggaatcgcgaaggtcgtttg
caggcagcttgtaacctagttcagcggggaattaccaacctctgtgttatcggaggtgac
ggcagtctgacaggcgctaacctgttccgagaagaatggagcgggcttcttgacgaactc
gtgcaaactgggaaaattgaggcggaagcagctaaagagtatgcccatctgaacattgtg
gggatggtgggatctatagataatgatttctgtggaactgatatgaccattggaacagac
tcagccctgcataggattatggaagttgttgacgctatcatgaccaccgctctaagccac
cagaggaccttcgtgctggaagtcatgggaagacactgcgggtacctcgccttggtcagt
gccttagcttgtggggcagactggatgtttatccctgaatccccaccggaggagggatgg
gaagacttgatgtgcaacaaactgtctgagaatcgtgcaaggaagaaaaggcttaatatc
atcattgtatcagaaggggctattgactgccataataagccaatcacgtcagacttggtt
aaagatctggttgtaaaacgcctgggatttgatactcgtgttacaattttgggccatgtc
caaagaggtggaaccccatcagccttcgacagaattctggcaagtcgaatgggagtggat
tgtgtcttggccctgcttgaagctactccagaaacgccggcctgtgttgtgtcgttatgt
ggaaaccaagctgtgcgcctgccccttatggaatgcgttcagatgacccaggaagtgcag
aaggccatggatgaaagaagatttgaagatgctgtaaggttacgaggaaggagctttgaa
aataacctcaacacttacaagcttctctcccataagaaaaatatatcagagcttccaaag
agtaatttcaacgtggctgttttgaatgtgggggcacccgctgcgggcatgaacgccgca
gtcagatctgcagtgagagtgggaataacagagggacataaaatgtttgccgtcaatgat
ggttttgaaggatttgccaaggggcagattaaagagataaaatggggaggtgttggaggc
tggacaggccaaggtggatctcttttgggaacaaagaggacccttcctgctaaatacttt
gaccaaattgcagagcaaatccgaacgaataaaattcacgctcttcttgtcattggtgga
tttgaggccttcttgggactgctggaaatggttgagggccgagggaaatatgatgagttc
tgtatccctatggtcatggttcccgctactgtctccaacaatgtgcccggctcagatttc
agcattggtgcagatacagctctgaacactataaccgatacctgcgatcgcatcaaacag
tcagcgagtggaaccaaacggcgtgtgttcatcattgaaacgatgggtggctactgcggc
tacttggctaacatgggcggccttgcagctggtgcagacgcggcatacatcttcgaagaa
tcgtttgatattcgcgaactccaggcaaacgtggaacatttaacagagaaaatgaaaaca
agcatccaaagaggacttatactcaggaatgagaacagcaatgagaactacaccacagat
ttcatttatcagctttactcagaagaaggccgaggcgtgttcgactgcagaaagaatgta
ctggggcacatgcagcagggcggcgctccgtctccgtttgacagaaacttcggcaccaag
atttccgccaaagccgtccagtggatttccaagaagttaaaagaaacctacaggaacggc
agggtatttgcaaacacagacgatagcgtttgtctgttaggaatgcgcaggaggaacctc
cttttccagccagtgacacaactcaaggacgaaacagactttaagcacaggattcccagg
gaacagtggtggctgaagatgaggcctctgatgaagattctggccaagtacaagacgagc
tacgacatttcagacgcaggaaaactggaacacgttaacatgtgcagacggaaagatgaa
acgggagcaatttga

DBGET integrated database retrieval system