KEGG   Xenopus laevis (African clawed frog): 379638Help
Entry
379638            CDS       T01010                                 

Gene name
map2k6, MEK6, MKK6, SAPKK3
Definition
mitogen-activated protein kinase kinase 6 (EC:2.7.12.2)
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Toll-like receptor signaling pathway
GnRH signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xla04010]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:xla04620]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:xla04912]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 335 aa AA seqDB search
MAQPRGRKKNPGLKIPKEAFDQPHASSPTPPRDLDSKACILIGEKNFEVKADDLEPIEEL
GRGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCHFTVTFYGAL
FREGDVWICMELMDTSLDKFYKDVIDKGLTIPEDILGKIAVSIVKALEHLHSKLSVIHRD
VKPSNVLINKEGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYSVKSD
IWSLGITLIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSKCLKKNS
KERPTYPELMQHPFFVLHESKNTDVASFVKRILGD
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaccgagaggcaggaagaaaaatccagggctgaaaattccaaaggaagcattt
gaccagccgcatgccagctctccgacgcctccacgggacttggactctaaagcctgtatc
ctcataggagaaaagaactttgaagttaaggctgatgacttggaaccaatagaagaactg
ggccggggagcctatggagtcgtggagaagatgcgccatgttcccagtgagcagataatg
gcagtgaagcgcatcagagctactgtgaacagccaagaacagaaaaggctgctgatggac
ctggatatctctatgcgcacagtggattgccattttactgtcacattttatggggcttta
tttagagagggggatgtctggatctgcatggagttgatggacacgtcactggataaattt
tacaaggatgtgattgacaaaggcctgaccatccccgaggacatactaggaaaaatagca
gtttcaattgttaaagcattagaacatctgcatagcaaactctccgtaatccacagagat
gtgaaaccctccaatgtactgatcaacaaagaaggtcaggtgaagatgtgtgactttgga
attagtggttatctcgttgactctgtagccaaaaccatggatgccggctgcaaaccttac
atggctcctgaaaggataaacccagaactgaaccagaaaggatacagtgtgaaatctgac
atttggagccttggaatcacattgattgaactggccattttacggtttccatatgactcc
tgggggacccccttccaacagctaaaacaggtggtcgaagagccgtccccacagctgcct
gcagacaagttttctgctgaatttgttgactttacctcaaagtgcttgaagaaaaattcc
aaagagcgtccaacatatccagagcttatgcaacaccctttctttgtgctgcatgaatcc
aagaacactgatgtggcatctttcgttaaacgtatcttgggagactaa

DBGET integrated database retrieval system