KEGG   Xenopus laevis (African clawed frog): 379638Help
Entry
379638            CDS       T01010                                 

Gene name
map2k6, MEK6, MKK6, SAPKK3
Definition
mitogen-activated protein kinase kinase 6 (EC:2.7.12.2)
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
Toll-like receptor signaling pathway
GnRH signaling pathway
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    379638 (map2k6)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    379638 (map2k6)
  Endocrine system
   04912 GnRH signaling pathway
    379638 (map2k6)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     379638 (map2k6)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   379638 (map2k6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 335 aa AA seqDB search
MAQPRGRKKNPGLKIPKEAFDQPHASSPTPPRDLDSKACILIGEKNFEVKADDLEPIEEL
GRGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCHFTVTFYGAL
FREGDVWICMELMDTSLDKFYKDVIDKGLTIPEDILGKIAVSIVKALEHLHSKLSVIHRD
VKPSNVLINKEGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYSVKSD
IWSLGITLIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSKCLKKNS
KERPTYPELMQHPFFVLHESKNTDVASFVKRILGD
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaccgagaggcaggaagaaaaatccagggctgaaaattccaaaggaagcattt
gaccagccgcatgccagctctccgacgcctccacgggacttggactctaaagcctgtatc
ctcataggagaaaagaactttgaagttaaggctgatgacttggaaccaatagaagaactg
ggccggggagcctatggagtcgtggagaagatgcgccatgttcccagtgagcagataatg
gcagtgaagcgcatcagagctactgtgaacagccaagaacagaaaaggctgctgatggac
ctggatatctctatgcgcacagtggattgccattttactgtcacattttatggggcttta
tttagagagggggatgtctggatctgcatggagttgatggacacgtcactggataaattt
tacaaggatgtgattgacaaaggcctgaccatccccgaggacatactaggaaaaatagca
gtttcaattgttaaagcattagaacatctgcatagcaaactctccgtaatccacagagat
gtgaaaccctccaatgtactgatcaacaaagaaggtcaggtgaagatgtgtgactttgga
attagtggttatctcgttgactctgtagccaaaaccatggatgccggctgcaaaccttac
atggctcctgaaaggataaacccagaactgaaccagaaaggatacagtgtgaaatctgac
atttggagccttggaatcacattgattgaactggccattttacggtttccatatgactcc
tgggggacccccttccaacagctaaaacaggtggtcgaagagccgtccccacagctgcct
gcagacaagttttctgctgaatttgttgactttacctcaaagtgcttgaagaaaaattcc
aaagagcgtccaacatatccagagcttatgcaacaccctttctttgtgctgcatgaatcc
aagaacactgatgtggcatctttcgttaaacgtatcttgggagactaa

DBGET integrated database retrieval system