KEGG   Xenopus laevis (African clawed frog): 379685Help
Entry
379685            CDS       T01010                                 

Gene name
kat7, hbo1, hboa, myst2
Definition
K(lysine) acetyltransferase 7 (EC:2.3.1.48)
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     379685 (kat7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 617 aa AA seqDB search
MPRRKRNAGSSSDGTEDSDFSTDMEHTDSSESDGNSRGPARVTRSTARLSQSSQDSSPVG
NLQSFGAEEPGYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVADFCDRDAKITGD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESVAKDMSLKDSESDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKNCDEFQVRAQSRDKQVDER
MLSHRQDENNRHSTRHQAPTERQLRYKEKVTELRKKRNSGLTKEQKEKYMEHRQTHGDTR
EPLLENLTSEYDLELFRRAQARASDDLEKLRLQGQITEGSNMIKTILFGRYELDTWYHSP
YPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKSSISVFEVDGKKN
KIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNAGCHLIGYFSKEKNSFLNYNVSC
ILTMPQYMRQGYGKMLIDFSYLLSKVEDKVGSPERPLSDLGLISYRSYWKEVLLRYLHNF
QGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWASKDAKRTNS
NKAMDPGCLKWTPPKGT
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgccccggaggaagaggaatgctggaagcagttcggatgggacagaagattcagatttc
tctacagacatggaacacacagacagctcagagagtgacggcaactcccggggtcctgct
cgagtcactcgatccactgcaagactcagtcagagctctcaggattccagcccagtgggc
aatctgcagtcgtttggtgcagaggagccgggctactccactcggagggtgacccgcagc
cagcagcagcccacccccgtgactccgaaaaagtacccactccgacagacccgctcatcg
ggatcagaaactgagcaggtggcggacttttgtgacagagatgccaaaatcacgggggat
cacgacgagtcgcctcctcgcactccaacagggaatgccccgtcttctgagtctgacatt
gacatttccagccccaacgtgtctcacgacgagagcgttgccaaggacatgtccctcaag
gactctgaaagtgacctctcccacaggcctaaacgcagacgctttcacgagagctacaac
tttaacatgaagtgccccactcccggatgcaactcattgggtcacctgactgggaaacat
gagaggcacttctccatttcggggtgccctctgtaccacaacctgtctgcagatgaatgc
aagaattgtgatgaatttcaggtaagagcacagagccgagataagcaggtggatgagcgg
atgctttcacatagacaggatgaaaataacaggcattctaccagacaccaggctcccaca
gaacgtcagctgaggtacaaggaaaaggtcaccgagctgagaaaaaagcgcaactctggc
ctgactaaggagcagaaagagaagtacatggagcacagacagacccatggagacacaagg
gaacctctcttagaaaacttgaccagcgagtatgacctggagctatttcgaagggctcaa
gccagagcgtccgatgacctggagaagctgagacttcagggccagatcacggaaggaagc
aacatgattaaaacgatcctctttggtcggtatgaactagacacgtggtatcactctcct
taccccgaggagtacgcccgtctgggacgactgtacatgtgcgaattctgcctgaagtac
atgaagagccagacgatcctccgcagacacatggctaaatgtgtttggaagcatccccca
ggcgacgagatctaccgtaaaagctccatctctgtctttgaggtcgacggaaaaaagaat
aagatatactgccagaatctgtgccttctcgctaaactgttcctggaccataaaacactc
tactacgacgtggaaccattcctcttctacgtcatgactgaggcagacaacgctggctgt
cacctcattggctacttttccaaggagaagaactcgttcctgaactacaatgtgtcttgt
atcctgacaatgccacagtacatgagacagggttatggcaagatgctcatagacttcagt
tacctgctgtctaaggtggaagacaaagtgggctcaccagagcgccctctctcagacctg
ggtctcatcagctaccgcagctactggaaagaagtgctgctccgctacttgcacaatttt
caaggcaaagagatttccatcaaagagatcagccaggagacggcggtgaatccggtggat
atagtcagcacgttgcaggccctacagatgctcaagtactggaaggggaagcacttggtg
ttaaagagacaggatctgatcgatgaatgggcatccaaggacgccaagagaaccaacagc
aataaagcaatggaccccggctgtctaaaatggacgcctcctaaaggaacttaa

DBGET integrated database retrieval system