KEGG   Xenopus laevis (African clawed frog): 379689Help
Entry
379689            CDS       T01010                                 

Gene name
ppt2-a, g14, ppt2
Definition
palmitoyl-protein thioesterase 2 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:xla00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    379689 (ppt2-a)
  Lipid metabolism
   00062 Fatty acid elongation
    379689 (ppt2-a)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    379689 (ppt2-a)
Enzymes [BR:xla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     379689 (ppt2-a)
Lipid biosynthesis proteins [BR:xla01004]
 Fatty acid synthase
  Component type
   379689 (ppt2-a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 296 aa AA seqDB search
MTASRPKALQTFCLLLPLLVWMVDRSLCYKPVIVVHGLFDSSANFKNLLQYINESHPGTN
VTVLDLFDNKESLQPLWKQVQGFKEAIYPIMQNAGRDGVHLLCYSQGGLICRGLLQTMPD
HNVDTFISLSSPQMGQYGDTDYLRYLFPTYVKSNLYRLCYTQMGQTFSICNFWNDPHHHG
IYVNVSDFLAPLNSERPEPNATDWKKNFLRLRKMVLIGGPDDGVITPWESSHFGFYDENE
TVLEMKYQMVYQDDTFGLRSMDYRGAITVYGVPGVVHTMWHSNQTVFKNCIEKWLT
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgactgcatccaggccaaaagcactgcaaacattttgccttctgttacctcttctggtt
tggatggtggaccgctcattatgttacaagccagtcattgtggtccatggattgtttgac
agctcagccaactttaagaatctcttacagtatatcaatgagtctcacccaggaaccaat
gtcacagtcttggacctgtttgataacaaggagagtttgcagcctctgtggaagcaggtg
caaggtttcaaagaagcaatctatccaataatgcagaatgcgggcagggatggtgtgcat
ctgctatgttattcacagggagggttgatttgccgtggtcttttgcagaccatgccagac
cacaatgttgatacttttatttctctctcttcccctcaaatgggccagtatggagacaca
gattatctaaggtatctgttccccacatacgtgaaatccaacttgtaccgattgtgttat
acacagatgggtcagaccttttccatctgcaacttttggaatgatccacatcatcatgga
atatacgtaaatgtcagtgatttccttgccccgttgaactctgaaaggccagaacccaat
gccacagactggaagaagaattttctacgtctccgtaaaatggttcttattggcggcccc
gacgatggggttattactccatgggagtctagccactttgggttttatgatgaaaatgag
accgttttggaaatgaaatatcaaatggtataccaagatgacacatttggacttcgctct
atggattaccgaggagcaatcactgtatatggtgtgccaggggttgttcacactatgtgg
cattcaaaccagacagttttcaaaaactgcattgaaaaatggcttacttaa

DBGET integrated database retrieval system