KEGG   Xenopus laevis (African clawed frog): 379707Help
Entry
379707            CDS       T01010                                 

Gene name
por, npr, xpor
Definition
P450 (cytochrome) oxidoreductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     379707 (por)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 680 aa AA seqDB search
MGESCTEQDMCTSEQGNGSPEEAFFSMADMFLLSLIVGLLTYWFFFRKKKEETIEFTKIQ
PTVNNSVRESSFIEKMKKTGKNIVVFYGSQTGTGEEFANRLAKDAHRYGVRGMAADPEEF
EMADLSRLTEIENALAVFCMATYGEGDPTDNAQDFYDWLQETDIDLTGLKYAVFGLGNKT
YEHFNAMGKYVDKRLEELGAERIFELGMGDDDGNLEEDFITWREQFWPAVCEHFGVEATG
EDSSIRQYELVVHTDENMNKVYTGEMGRLKSYETQKPPFDAKNPFLANVTVNRKLNEGGD
RHLMHLELDVTGSKIRYESGDHVAVYPANDTALVNKLGEILGADLDTVISLNNLDEESNK
KHPFPCPTTYRTALTYYLDITNPPRTNVLYELAQYATDSKEQENLRKMASSAQDGKGLYL
SWVVESRRNILAILEDVPSLRPPLDHLCELLPRLQARYYSIASSSKVHPSSIHVCAVLVE
YETKTGRENKGVATNWLKNKQPSDNGHKSSVPMYVRKSQFRLPFKPSTPVIMIGPGTGIA
PFIGFIQEREWLKQQGKDVGETVLYYGCRHEHEDFLYKDELKRYHKDGVLTQLNVAFSRD
QDRKVYVQHLLKDNKEMVWKLIHEDNAHIYVCGDARNMARDVQNTFYDIVAEYGKIDHAQ
AVDYIKKLMTKGRYSQDVWS
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgggggagtcttgtacggaacaagatatgtgtacatccgagcaggggaatggctctcct
gaagaagcatttttcagtatggcagatatgtttcttttgtctctcatagttggcctgctg
acttactggttcttttttcggaaaaagaaagaagagaccattgaattcaccaaaattcaa
cccactgtgaataactctgttcgagaaagcagttttatcgaaaagatgaaaaagaccgga
aaaaacattgtagtattctatggttctcagactggaacaggagaagaatttgccaatcga
ctggccaaggatgctcaccgatatggcgtgcgtgggatggctgctgacccagaagaattt
gaaatggcagatctcagtcgtctcacagaaatcgagaacgctcttgctgttttttgcatg
gccacttatggggaaggtgatcctacagataatgctcaggatttttatgactggcttcag
gaaaccgacattgaccttacagggcttaagtatgcagtttttggccttggcaacaagaca
tatgagcactttaatgccatgggaaaatatgttgacaaaagacttgaagaattaggagct
gagcgcatttttgagctgggaatgggagacgacgatggcaatctggaggaagactttatc
acatggagggagcagttctggcctgcagtttgtgaacactttggagttgaggcaactgga
gaagattccagcattcgtcagtatgaacttgtggtgcacacagatgagaacatgaacaag
gtctacacaggagagatgggccgactaaagagttatgaaactcaaaaaccaccatttgat
gctaaaaaccctttcttggctaacgtaacagtcaaccgcaaactaaatgagggtggagac
cgacatttgatgcatttggaactagatgtcactggctcaaagataagatatgagtctgga
gatcatgtggctgtgtacccagcaaatgatactgcactcgtaaacaagttgggagagatt
ctgggggctgacctggacacagtaatttctctaaacaacttggatgaggagtctaacaaa
aagcaccctttcccctgtcctaccacatatcgtactgccctcacttattacttggacatt
accaatccacccaggaccaatgtgctttatgagctagctcagtatgccacagactccaag
gagcaagaaaacctgcgcaagatggcctcctcagcacaagatggcaagggtctctatctc
agttgggttgttgaatcaagaagaaatattctggccatactagaagatgtaccttcactg
cgccctccattggatcacctttgtgagctactgccacgactacaagcccgatattactcc
attgcatcatcctcaaaagttcatcccagttccatccacgtgtgtgccgtgcttgttgaa
tatgaaaccaaaacaggcagagaaaataaaggagtggctacaaattggctcaaaaataaa
cagcccagtgacaatggacacaagtcgtcagttcccatgtatgtgcgcaaatcccagttc
cgccttccattcaagcccagcacaccagtcatcatgattggtcctgggacaggcattgcc
ccattcattggtttcatccaagaaagagagtggctgaagcagcaaggcaaggatgttggg
gaaactgtgctgtactatggctgccgtcatgaacatgaagatttcctttacaaagatgaa
ttaaaacggtatcacaaggatggcgttctgacccaattgaacgttgccttctcacgagac
caagaccgaaaggtttatgtgcagcatcttctcaaggacaacaaagagatggtatggaag
ctaatccatgaagataatgcccacatttatgtctgcggtgatgcccgcaacatggctcgg
gatgtgcagaacactttctatgacattgtggcagaatatggcaaaattgaccatgctcag
gctgtggattacatcaagaaactaatgaccaaaggccgctattcccaggatgtgtggagt
taa

DBGET integrated database retrieval system