KEGG   Xenopus laevis (African clawed frog): 379743Help
Entry
379743            CDS       T01010                                 

Gene name
pdia3, erp57, grp58
Definition
protein disulfide isomerase family A, member 3 (EC:5.3.4.1)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:xla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    379743 (pdia3)
Enzymes [BR:xla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     379743 (pdia3)
Exosome [BR:xla04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   379743 (pdia3)
  Exosomal proteins of colorectal cancer cells
   379743 (pdia3)
  Exosomal proteins of bladder cancer cells
   379743 (pdia3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 502 aa AA seqDB search
MNRQLLGAFFLLLAVTAGTQAAGSDVLDLTDDNFESVVAQHSILLVEFFAPWCGHCKKLA
PEYEIAATKLKGTLSLAKVDCTANSNICNKYGVSGYPTLKIFRDGEDSGSYDGPRSADGI
VSTMKKQAGPASVDLRSVEEFEKFVADKDAAVVGFFRDLYSGPHSEFLKAANTLRENYRF
AHTDEKELVDKYDTNGEGVVLFRPPHLANKFEDGSVTFPADEKITSGKIKKFIQDNIFGL
CPHLTQDNKDLIQGKDLLIAYYDVDYEKNVKGTNYWRNRVMKVAKSFVDAGKKLNFAVAN
RKSFGHEVTEFGLDANTGELPVVGIKTAKGEKFVMQEEFSRDGKALERFLQDYFDGKLKR
YMKSESIPESNDGPVKVAVAENFDELVNDESKDVLIEFYAPWCGHCKTLEPKYKELGEKL
ADDPNIVIAKMDATANDVPPQYEVRGFPTIYFAPAGNKQNPKRYEGGREVSEFLSYLKKE
ATNPPVVKEDEKPKKKKKKEEL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggcaactcctcggcgccttcttcctcctcctggctgtcaccgccggcactcag
gccgcaggttcagatgtcctggatctcaccgacgataactttgaaagcgtcgtagctcag
cacagcatcttgctagtggagttcttcgctccctggtgtggtcattgtaagaaactagct
cctgaatatgaaattgcagccactaagcttaaagggacactttctttggctaaggttgac
tgcacagccaattccaacatttgcaacaaatatggagtcagtggataccctactctaaaa
atattcagagatggagaggactctggatcttacgatgggccaagatctgctgatggaatt
gttagtactatgaagaaacaagctggaccagcatcagtagatctccgatctgttgaggaa
tttgaaaaatttgttgctgataaagatgctgctgtggtcggatttttccgggacttgtat
agtggccctcactctgagtttcttaaagctgcaaacacccttagagagaactatcgcttt
gctcacacagatgaaaaagagcttgtggacaaatatgatacaaatggagagggtgttgtc
ttgttccgcccaccacacctggcaaacaaatttgaagacggctctgtgacattccctgct
gatgagaaaataaccagcggcaaaattaaaaagttcattcaagataacatttttggtctc
tgccctcacttgacacaagacaacaaagatttgatccaaggaaaggacttgcttatcgca
tattatgatgttgactatgaaaagaatgtcaagggtaccaattattggcgaaacagagta
atgaaggttgcaaagtcctttgttgatgctggcaaaaaactaaattttgctgttgctaac
cggaaatcctttggacatgaagtgacagaatttggtttggatgccaatactggggaactt
cctgttgttggaatcaaaactgctaaaggcgagaaatttgtcatgcaagaagaattctcc
cgtgatggaaaagctttggaaagattccttcaggattattttgatggtaaactgaagaga
tacatgaaatctgaatccatccctgaaagtaacgacgggcctgttaaggtggcggtagct
gaaaactttgacgaacttgtcaacgatgaaagcaaagatgtactaattgagttctatgct
ccatggtgtggccattgtaagaccttggaacctaaatacaaagaacttggagagaagctt
gccgatgatccaaacattgtgattgccaagatggatgccacagcaaacgatgtgcctcct
caatatgaagttagagggttccccacaatttactttgctcctgcaggaaataagcaaaac
ccaaagagatatgagggtggtagagaggtgagcgagttccttagctatctgaagaaggag
gcaacaaaccctccagtcgttaaggaagatgaaaaacccaaaaagaagaagaagaaggaa
gagttataa

DBGET integrated database retrieval system