KEGG   Xenopus laevis (African clawed frog): 379763Help
Entry
379763            CDS       T01010                                 

Gene name
clk2
Definition
CDC-like kinase 2 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
xla  Xenopus laevis (African clawed frog)
Brite
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     379763 (clk2)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   379763 (clk2)
Spliceosome [BR:xla03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    379763 (clk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 491 aa AA seqDB search
MPHSRRYGSSERGSYRSRKHRRRRSRSRSSSSSSDRGRERRHMHGDGYHERSRSYEERSS
DRRAYDRRYCDSYRRNDYSRDRGDVYYETDYDYKHSRDDSYRSTRRKQKRRNRRTRSYSQ
SSSRSRQSSRRAKSVEDDVEGHLIYHSGDWLQERYEIVSTLGEGTFGRVVQCKDHRRGGS
RVALKIIKNVEKYKEAARLEINVLEKINEKDPENKHLCVQMFDWFDYHGHMCISFELLGL
STFDFLKENNYFPYPIHQVRHMALQLCQAMKFLHDNKLTHTDLKPENILFVSSDYELRYN
MEKKRDERCVKSTDIRVVDFGSATFDHEHHSTIVSTRHYRAPEVLLELGWNQPCDVWSVG
CIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYHGRLDWDDNTSAG
RYVRENCKPLRRYMMMETEEHHQFFNLIEGLLGYEPSKRMTLAAALKHPFFNPLKGDPTL
KHWDTGRDISR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcctcactccagacgttacggttcgtcagagaggggcagttacagaagtcgcaagcac
aggaggagaaggagcaggtcacggagcagcagtagtagtagtgacagaggccgtgagcgc
aggcacatgcacggtgacggttaccatgagaggtctcgcagttatgaagagcgctcgtca
gacagaagagcttatgatcggcgttactgtgacagctacagaaggaacgactacagcagg
gacagaggggacgtgtactacgagacagactatgactacaagcactctcgggacgacagc
tacaggagcactcgccgcaaacagaagcggaggaatcgcagaaccaggtcttatagccag
tcctcatcgaggagtcgccagagcagccggcgggcaaagagtgttgaagacgacgtggag
ggccacctgatctatcacagcggcgactggctacaagaaagatatgagattgtgagcaca
cttggggaaggaacgtttggccgagttgttcagtgcaaagatcacaggaggggaggatcc
agagtggcattaaaaatcatcaaaaacgtggagaaatacaaagaggcggctcgtctggag
atcaacgtattagaaaagatcaacgagaaggatccggagaacaaacacctgtgtgtgcag
atgtttgactggttcgactatcacggacacatgtgcatctccttcgagctgcttggtctc
agcacatttgacttcctgaaagagaacaactacttcccgtaccctatccaccaagtccga
cacatggccctgcagttgtgccaagctatgaaatttctacatgacaacaaactgactcac
actgacctcaagccagaaaatatcctatttgtcagttctgactatgagctgaggtacaac
atggagaagaaacgagacgagagatgcgtcaagagcacagacatcagggttgtggacttt
ggcagcgccacatttgatcacgagcatcacagcaccattgtttccacacgccattaccgg
gcaccagaggttctactggagctgggctggaaccaaccctgtgatgtctggagcgttggc
tgcattatatttgagtactacgtggggttcaccctcttccagacccatgataaccgtgag
catttagccatgatggagagaatactcggccccatcccctcacggatgattagaaaaacc
aggaagcagaagtatttctaccatggacgccttgactgggatgataacacatcagcaggt
cgatatgtgcgagagaattgcaagcccctaaggaggtacatgatgatggagactgaggaa
caccaccagttctttaatctgattgagggattactgggatatgaaccctccaagcgcatg
acactggcagcggctctcaagcacccttttttcaacccgttgaagggagacccaacactt
aagcactgggacactggccgggacataagccgatga

DBGET integrated database retrieval system