KEGG   Xenopus laevis (African clawed frog): 379763Help
Entry
379763            CDS       T01010                                 

Gene name
clk2
Definition
CDC-like kinase 2 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
xla  Xenopus laevis (African clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 491 aa AA seqDB search
MPHSRRYGSSERGSYRSRKHRRRRSRSRSSSSSSDRGRERRHMHGDGYHERSRSYEERSS
DRRAYDRRYCDSYRRNDYSRDRGDVYYETDYDYKHSRDDSYRSTRRKQKRRNRRTRSYSQ
SSSRSRQSSRRAKSVEDDVEGHLIYHSGDWLQERYEIVSTLGEGTFGRVVQCKDHRRGGS
RVALKIIKNVEKYKEAARLEINVLEKINEKDPENKHLCVQMFDWFDYHGHMCISFELLGL
STFDFLKENNYFPYPIHQVRHMALQLCQAMKFLHDNKLTHTDLKPENILFVSSDYELRYN
MEKKRDERCVKSTDIRVVDFGSATFDHEHHSTIVSTRHYRAPEVLLELGWNQPCDVWSVG
CIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYHGRLDWDDNTSAG
RYVRENCKPLRRYMMMETEEHHQFFNLIEGLLGYEPSKRMTLAAALKHPFFNPLKGDPTL
KHWDTGRDISR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcctcactccagacgttacggttcgtcagagaggggcagttacagaagtcgcaagcac
aggaggagaaggagcaggtcacggagcagcagtagtagtagtgacagaggccgtgagcgc
aggcacatgcacggtgacggttaccatgagaggtctcgcagttatgaagagcgctcgtca
gacagaagagcttatgatcggcgttactgtgacagctacagaaggaacgactacagcagg
gacagaggggacgtgtactacgagacagactatgactacaagcactctcgggacgacagc
tacaggagcactcgccgcaaacagaagcggaggaatcgcagaaccaggtcttatagccag
tcctcatcgaggagtcgccagagcagccggcgggcaaagagtgttgaagacgacgtggag
ggccacctgatctatcacagcggcgactggctacaagaaagatatgagattgtgagcaca
cttggggaaggaacgtttggccgagttgttcagtgcaaagatcacaggaggggaggatcc
agagtggcattaaaaatcatcaaaaacgtggagaaatacaaagaggcggctcgtctggag
atcaacgtattagaaaagatcaacgagaaggatccggagaacaaacacctgtgtgtgcag
atgtttgactggttcgactatcacggacacatgtgcatctccttcgagctgcttggtctc
agcacatttgacttcctgaaagagaacaactacttcccgtaccctatccaccaagtccga
cacatggccctgcagttgtgccaagctatgaaatttctacatgacaacaaactgactcac
actgacctcaagccagaaaatatcctatttgtcagttctgactatgagctgaggtacaac
atggagaagaaacgagacgagagatgcgtcaagagcacagacatcagggttgtggacttt
ggcagcgccacatttgatcacgagcatcacagcaccattgtttccacacgccattaccgg
gcaccagaggttctactggagctgggctggaaccaaccctgtgatgtctggagcgttggc
tgcattatatttgagtactacgtggggttcaccctcttccagacccatgataaccgtgag
catttagccatgatggagagaatactcggccccatcccctcacggatgattagaaaaacc
aggaagcagaagtatttctaccatggacgccttgactgggatgataacacatcagcaggt
cgatatgtgcgagagaattgcaagcccctaaggaggtacatgatgatggagactgaggaa
caccaccagttctttaatctgattgagggattactgggatatgaaccctccaagcgcatg
acactggcagcggctctcaagcacccttttttcaacccgttgaagggagacccaacactt
aagcactgggacactggccgggacataagccgatga

DBGET integrated database retrieval system