KEGG   Xenopus laevis (African clawed frog): 379783Help
Entry
379783            CDS       T01010                                 

Gene name
akt2.L, akt2, akt2-a, pkbb, pkbbeta, pkbss, prkbb, rac-beta, v-akt2
Definition
(RefSeq) v-akt murine thymoma viral oncogene homolog 2 L homeolog
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
xla04010  MAPK signaling pathway
xla04012  ErbB signaling pathway
xla04068  FoxO signaling pathway
xla04140  Autophagy - animal
xla04150  mTOR signaling pathway
xla04210  Apoptosis
xla04218  Cellular senescence
xla04261  Adrenergic signaling in cardiomyocytes
xla04370  VEGF signaling pathway
xla04371  Apelin signaling pathway
xla04510  Focal adhesion
xla04620  Toll-like receptor signaling pathway
xla04625  C-type lectin receptor signaling pathway
xla04910  Insulin signaling pathway
xla04914  Progesterone-mediated oocyte maturation
xla04920  Adipocytokine signaling pathway
xla04933  AGE-RAGE signaling pathway in diabetic complications
Module
xla_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    379783 (akt2.L)
   04012 ErbB signaling pathway
    379783 (akt2.L)
   04370 VEGF signaling pathway
    379783 (akt2.L)
   04371 Apelin signaling pathway
    379783 (akt2.L)
   04068 FoxO signaling pathway
    379783 (akt2.L)
   04150 mTOR signaling pathway
    379783 (akt2.L)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    379783 (akt2.L)
  Cell growth and death
   04210 Apoptosis
    379783 (akt2.L)
   04218 Cellular senescence
    379783 (akt2.L)
  Cellular community - eukaryotes
   04510 Focal adhesion
    379783 (akt2.L)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    379783 (akt2.L)
   04625 C-type lectin receptor signaling pathway
    379783 (akt2.L)
  Endocrine system
   04910 Insulin signaling pathway
    379783 (akt2.L)
   04920 Adipocytokine signaling pathway
    379783 (akt2.L)
   04914 Progesterone-mediated oocyte maturation
    379783 (akt2.L)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    379783 (akt2.L)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    379783 (akt2.L)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     379783 (akt2.L)
Protein kinases [BR:xla01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   379783 (akt2.L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 379783
NCBI-ProteinID: NP_001080091
Xenbase: XB-GENE-484172
UniProt: Q7ZX15 A0A1L8F8Y4
Position
8L
AA seq 486 aa AA seqDB search
MNEVMVIKEGWLQKRGEYIKTWRPRYFLLKSDGSFIGYKEKPESTEHNVVLPPLNNFSVA
ECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDTPEEREEWIIAIQTVANGLKNQVPEDE
EEEAMEVKYGSPSDVSSAEQMDVAMSKGHPKVTMNDFDYLKLLGKGTFGKVILVREKATG
RYYAMKILRKEVIIAKDEVAHTLTESRVLQNTKHPFLTALKYAFQTSDRLCFVMEYANGG
ELFFHLSRERVFTEDRARFYGAEIVSALEYLHSRNVVYRDIKLENLMLDKDGHVKITDFG
LCKEGITDGATMRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDH
ERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPNDAQEVMSHRFFVSINWQ
DVTERKLTPPFKPQVTSEIDTRYFDDEFTAQSITLTPPDRYDNLDALESDQRPHFPQFSY
SASIRE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtgatggtgattaaagaaggttggcttcaaaaaagaggggagtatattaaa
acatggagaccacgatatttccttctgaaaagtgatggttcctttattggctataaagag
aagccagagtccacagagcacaatgtggtgcttccacccctcaataacttctctgttgca
gaatgtcagctaatgaagacagaacggcctaggcccaacacatttgtgattcggtgccta
caatggactaccgttattgaacggacttttcatgttgacacacctgaggaaagggaagaa
tggattattgccatccagacagtggccaatggcctgaagaaccaggtgcccgaagatgag
gaggaggaagccatggaagttaagtatggctcccccagcgatgtctcaagtgccgagcaa
atggatgttgcaatgtccaaagggcaccccaaagtgaccatgaatgattttgactacctc
aaattgctgggaaaagggacctttgggaaggttatccttgtccgagagaaagctaccgga
cgttactacgctatgaagatccttcgaaaagaggtcataattgctaaggatgaagttgct
catacacttacagaaagcagagttttgcagaacacaaaacacccgtttttgacggcatta
aagtatgcatttcagaccagtgacagactctgctttgttatggaatatgctaatggtgga
gagctttttttccatctttcacgagaacgagtttttacagaggacagagcacgcttttat
ggagcagagattgtgtctgctttagaatatctacattctcgaaatgtggtatacagagac
atcaagctggagaatctcatgctggataaggatggccatgtcaagattacagattttggt
ttgtgtaaagaaggcatcacagatggagctaccatgaggaccttctgtggcacaccagag
taccttgcccctgaggtgcttgaagataatgactatggtcgagctgtggactggtggggt
cttggagttgtgatgtatgaaatgatgtgtggacgattgcccttttataaccaagaccat
gagaggttatttgaactcatcctcatggaagagatccgctttccccgtacgttaagccca
gaggcaaaatctctgcttgctggactcttgaaaaaggatcctaaacagagactaggaggg
ggtcctaatgatgcccaagaggtcatgtcgcatcgattctttgtttctatcaattggcaa
gatgtaacggagagaaagctcacccctccattcaagccacaagtcacatcagagattgac
acaagatattttgatgacgagtttacagctcagtctataacattgacgcctcccgacaga
tatgataacctcgatgccttagaatcagatcagcgccctcattttcctcaattctcttat
tctgcaagcatacgggagtaa

DBGET integrated database retrieval system