KEGG   Xenopus laevis (African clawed frog): 379783Help
Entry
379783            CDS       T01010                                 

Gene name
akt2, akt2-a, pkbb, pkbbeta, pkbss, prkbb, rac-beta, v-akt2
Definition
v-akt murine thymoma viral oncogene homolog 2 (EC:2.7.11.1)
Orthology
K04456  
RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xla  Xenopus laevis (African clawed frog)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Tight junction
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xla00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    379783 (akt2)
   04012 ErbB signaling pathway
    379783 (akt2)
   04370 VEGF signaling pathway
    379783 (akt2)
   04630 Jak-STAT signaling pathway
    379783 (akt2)
   04068 FoxO signaling pathway
    379783 (akt2)
   04150 mTOR signaling pathway
    379783 (akt2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    379783 (akt2)
  Cellular commiunity
   04510 Focal adhesion
    379783 (akt2)
   04530 Tight junction
    379783 (akt2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    379783 (akt2)
  Endocrine system
   04910 Insulin signaling pathway
    379783 (akt2)
   04920 Adipocytokine signaling pathway
    379783 (akt2)
   04914 Progesterone-mediated oocyte maturation
    379783 (akt2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    379783 (akt2)
Enzymes [BR:xla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     379783 (akt2)
Protein kinases [BR:xla01001]
 Serine/threonine protein kinases: AGC group
  AKT family
   379783 (akt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
AA seq 486 aa AA seqDB search
MNEVMVIKEGWLQKRGEYIKTWRPRYFLLKSDGSFIGYKEKPESTEHNVVLPPLNNFSVA
ECQLMKTERPRPNTFVIRCLQWTTVIERTFHVDTPEEREEWIIAIQTVANGLKNQVPEDE
EEEAMEVKYGSPSDVSSAEQMDVAMSKGHPKVTMNDFDYLKLLGKGTFGKVILVREKATG
RYYAMKILRKEVIIAKDEVAHTLTESRVLQNTKHPFLTALKYAFQTSDRLCFVMEYANGG
ELFFHLSRERVFTEDRARFYGAEIVSALEYLHSRNVVYRDIKLENLMLDKDGHVKITDFG
LCKEGITDGATMRTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDH
ERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPNDAQEVMSHRFFVSINWQ
DVTERKLTPPFKPQVTSEIDTRYFDDEFTAQSITLTPPDRYDNLDALESDQRPHFPQFSY
SASIRE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtgatggtgattaaagaaggttggcttcaaaaaagaggggagtatattaaa
acatggagaccacgatatttccttctgaaaagtgatggttcctttattggctataaagag
aagccagagtccacagagcacaatgtggtgcttccacccctcaataacttctctgttgca
gaatgtcagctaatgaagacagaacggcctaggcccaacacatttgtgattcggtgccta
caatggactaccgttattgaacggacttttcatgttgacacacctgaggaaagggaagaa
tggattattgccatccagacagtggccaatggcctgaagaaccaggtgcccgaagatgag
gaggaggaagccatggaagttaagtatggctcccccagcgatgtctcaagtgccgagcaa
atggatgttgcaatgtccaaagggcaccccaaagtgaccatgaatgattttgactacctc
aaattgctgggaaaagggacctttgggaaggttatccttgtccgagagaaagctaccgga
cgttactacgctatgaagatccttcgaaaagaggtcataattgctaaggatgaagttgct
catacacttacagaaagcagagttttgcagaacacaaaacacccgtttttgacggcatta
aagtatgcatttcagaccagtgacagactctgctttgttatggaatatgctaatggtgga
gagctttttttccatctttcacgagaacgagtttttacagaggacagagcacgcttttat
ggagcagagattgtgtctgctttagaatatctacattctcgaaatgtggtatacagagac
atcaagctggagaatctcatgctggataaggatggccatgtcaagattacagattttggt
ttgtgtaaagaaggcatcacagatggagctaccatgaggaccttctgtggcacaccagag
taccttgcccctgaggtgcttgaagataatgactatggtcgagctgtggactggtggggt
cttggagttgtgatgtatgaaatgatgtgtggacgattgcccttttataaccaagaccat
gagaggttatttgaactcatcctcatggaagagatccgctttccccgtacgttaagccca
gaggcaaaatctctgcttgctggactcttgaaaaaggatcctaaacagagactaggaggg
ggtcctaatgatgcccaagaggtcatgtcgcatcgattctttgtttctatcaattggcaa
gatgtaacggagagaaagctcacccctccattcaagccacaagtcacatcagagattgac
acaagatattttgatgacgagtttacagctcagtctataacattgacgcctcccgacaga
tatgataacctcgatgccttagaatcagatcagcgccctcattttcctcaattctcttat
tctgcaagcatacgggagtaa

DBGET integrated database retrieval system